KEGG   Homo sapiens (human): 10380Help
Entry
10380             CDS       T01001                                 

Gene name
BPNT1, HEL20, PIP
Definition
3'(2'), 5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    10380 (BPNT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     10380 (BPNT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    10380 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 253 aa AA seqDB search
MSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVW
VDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGL
GAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASA
YVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYA
SRVPESIKNALVP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatgttcttcattggcccggaaattccccaaactcacaattataggggaagag
gatctgccttctgaggaagtggatcaagagctgattgaagacagtcagtgggaagaaata
ctgaagcaaccatgcccatcgcagtacagtgctattaaagaagaagatctcgtggtctgg
gttgatcctctggatggaaccaaggaatataccgaaggtcttcttgacaatgtaacagtt
cttattggaattgcttatgaaggaaaagccatagcaggagttattaaccagccatattac
aactatgaggcaggaccagatgctgtgttggggaggacaatctggggagttttaggttta
ggcgcctttgggtttcagctgaaagaagtccctgctgggaaacacattatcacaactact
cgatcccatagcaacaagttggttactgactgtgttgctgctatgaaccccgatgctgtg
ctgcgagtaggaggagcaggaaataagattattcagctgattgaaggcaaagcctctgct
tatgtatttgcaagtcctggttgtaagaagtgggatacttgtgctccagaagttatttta
catgctgtgggaggcaagttaaccgatatccatgggaatgttcttcagtaccacaaggat
gtgaagcatatgaactctgcaggagtcctggccacactgaggaattatgactactatgca
agccgagttccagaatctattaaaaatgcacttgttccttaa

DBGET integrated database retrieval system