KEGG   Homo sapiens (human): 103910Help
Entry
103910            CDS       T01001                                 

Gene name
MYL12B, MLC-B, MRLC2
Definition
myosin, light chain 12B, regulatory
Orthology
K12757  
myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.31
AA seq 172 aa AA seqDB search
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa
gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

DBGET integrated database retrieval system