KEGG   Homo sapiens (human): 103910Help
Entry
103910            CDS       T01001                                 

Gene name
MYL12B, MLC-B, MRLC2
Definition
myosin, light chain 12B, regulatory
Orthology
K12757  
myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    103910 (MYL12B)
  Cellular commiunity
   04510 Focal adhesion
    103910 (MYL12B)
   04530 Tight junction
    103910 (MYL12B)
 Organismal Systems
  Immune system
   04611 Platelet activation
    103910 (MYL12B)
   04670 Leukocyte transendothelial migration
    103910 (MYL12B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   103910 (MYL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.31
AA seq 172 aa AA seqDB search
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc
aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg
attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct
ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc
atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa
gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa
gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat
gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca
cgcatcctgaaacatggagccaaagacaaagatgactga

DBGET integrated database retrieval system