KEGG   Homo sapiens (human): 10392Help
Entry
10392             CDS       T01001                                 

Gene name
NOD1, CARD4, CLR7.1, NLRC1
Definition
(RefSeq) nucleotide binding oligomerization domain containing 1
  KO
K08727  nucleotide-binding oligomerization domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05133  Pertussis
Disease
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    10392 (NOD1)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    10392 (NOD1)
   05131 Shigellosis
    10392 (NOD1)
   05133 Pertussis
    10392 (NOD1)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   10392 (NOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 CARD LRR_4 AAA_16 AAA_18 ABC_tran AAA_22 RsgA_GTPase Roc
Motif
Other DBs
NCBI-GeneID: 10392
NCBI-ProteinID: NP_006083
OMIM: 605980
HGNC: 16390
Ensembl: ENSG00000106100
Vega: OTTHUMG00000023923
Pharos: Q9Y239(Tchem)
UniProt: Q9Y239 A0A024RA73
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 953 aa AA seqDB search
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcagggccacagtgagatggaaataatcccatcagagtctcacccccacatt
caattactgaaaagcaatcgggaacttctggtcactcacatccgcaatactcagtgtctg
gtggacaacttgctgaagaatgactacttctcggccgaagatgcggagattgtgtgtgcc
tgccccacccagcctgacaaggtccgcaaaattctggacctggtacagagcaagggcgag
gaggtgtccgagttcttcctctacttgctccagcaactcgcagatgcctacgtggacctc
aggccttggctgctggagatcggcttctccccttccctgctcactcagagcaaagtcgtg
gtcaacactgacccagtgagcaggtatacccagcagctgcgacaccatctgggccgtgac
tccaagttcgtgctgtgctatgcccagaaggaggagctgctgctggaggagatctacatg
gacaccatcatggagctggttggcttcagcaatgagagcctgggcagcctgaacagcctg
gcctgcctcctggaccacaccaccggcatcctcaatgagcagggtgagaccatcttcatc
ctgggtgatgctggggtgggcaagtccatgctgctacagcggctgcagagcctctgggcc
acgggccggctagacgcaggggtcaaattcttcttccactttcgctgccgcatgttcagc
tgcttcaaggaaagtgacaggctgtgtctgcaggacctgctcttcaagcactactgctac
ccagagcgggaccccgaggaggtgtttgccttcctgctgcgcttcccccacgtggccctc
ttcaccttcgatggcctggacgagctgcactcggacttggacctgagccgcgtgcctgac
agctcctgcccctgggagcctgcccaccccctggtcttgctggccaacctgctcagtggg
aagctgctcaagggggctagcaagctgctcacagcccgcacaggcatcgaggtcccgcgc
cagttcctgcggaagaaggtgcttctccggggcttctcccccagccacctgcgcgcctat
gccaggaggatgttccccgagcgggccctgcaggaccgcctgctgagccagctggaggcc
aaccccaacctctgcagcctgtgctctgtgcccctcttctgctggatcatcttccggtgc
ttccagcacttccgtgctgcctttgaaggctcaccacagctgcccgactgcacgatgacc
ctgacagatgtcttcctcctggtcactgaggtccatctgaacaggatgcagcccagcagc
ctggtgcagcggaacacacgcagcccagtggagaccctccacgccggccgggacactctg
tgctcgctggggcaggtggcccaccggggcatggagaagagcctctttgtcttcacccag
gaggaggtgcaggcctccgggctgcaggagagagacatgcagctgggcttcctgcgggct
ttgccggagctgggccccgggggtgaccagcagtcctatgagtttttccacctcaccctc
caggccttctttacagccttcttcctcgtgctggacgacagggtgggcactcaggagctg
ctcaggttcttccaggagtggatgccccctgcgggggcagcgaccacgtcctgctatcct
cccttcctcccgttccagtgcctgcagggcagtggtccggcgcgggaagacctcttcaag
aacaaggatcacttccagttcaccaacctcttcctgtgcgggctgttgtccaaagccaaa
cagaaactcctgcggcatctggtgcccgcggcagccctgaggagaaagcgcaaggccctg
tgggcacacctgttttccagcctgcggggctacctgaagagcctgccccgcgttcaggtc
gaaagcttcaaccaggtgcaggccatgcccacgttcatctggatgctgcgctgcatctac
gagacacagagccagaaggtggggcagctggcggccaggggcatctgcgccaactacctc
aagctgacctactgcaacgcctgctcggccgactgcagcgccctctccttcgtcctgcat
cacttccccaagcggctggccctagacctagacaacaacaatctcaacgactacggcgtg
cgggagctgcagccctgcttcagccgcctcactgttctcagactcagcgtaaaccagatc
actgacggtggggtaaaggtgctaagcgaagagctgaccaaatacaaaattgtgacctat
ttgggtttatacaacaaccagatcaccgatgtcggagccaggtacgtcaccaaaatcctg
gatgaatgcaaaggcctcacgcatcttaaactgggaaaaaacaaaataacaagtgaagga
gggaagtatctcgccctggctgtgaagaacagcaaatcaatctctgaggttgggatgtgg
ggcaatcaagttggggatgaaggagcaaaagccttcgcagaggctctgcggaaccacccc
agcttgaccaccctgagtcttgcgtccaacggcatctccacagaaggaggaaagagcctt
gcgagggccctgcagcagaacacgtctctagaaatactgtggctgacccaaaatgaactc
aacgatgaagtggcagagagtttggcagaaatgttgaaagtcaaccagacgttaaagcat
ttatggcttatccagaatcagatcacagctaaggggactgcccagctggcagatgcgtta
cagagcaacactggcataacagagatttgcctaaatggaaacctgataaaaccagaggag
gccaaagtctatgaagatgagaagcggattatctgtttctga

DBGET integrated database retrieval system