KEGG   Homo sapiens (human): 10392Help
Entry
10392             CDS       T01001                                 

Gene name
NOD1, CARD4, CLR7.1, NLRC1
Definition
nucleotide-binding oligomerization domain containing 1
Orthology
K08727  
nucleotide-binding oligomerization domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Pertussis
Disease
H01358  
Atopic dermatitis
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p15-p14
AA seq 953 aa AA seqDB search
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcagggccacagtgagatggaaataatcccatcagagtctcacccccacatt
caattactgaaaagcaatcgggaacttctggtcactcacatccgcaatactcagtgtctg
gtggacaacttgctgaagaatgactacttctcggccgaagatgcggagattgtgtgtgcc
tgccccacccagcctgacaaggtccgcaaaattctggacctggtacagagcaagggcgag
gaggtgtccgagttcttcctctacttgctccagcaactcgcagatgcctacgtggacctc
aggccttggctgctggagatcggcttctccccttccctgctcactcagagcaaagtcgtg
gtcaacactgacccagtgagcaggtatacccagcagctgcgacaccatctgggccgtgac
tccaagttcgtgctgtgctatgcccagaaggaggagctgctgctggaggagatctacatg
gacaccatcatggagctggttggcttcagcaatgagagcctgggcagcctgaacagcctg
gcctgcctcctggaccacaccaccggcatcctcaatgagcagggtgagaccatcttcatc
ctgggtgatgctggggtgggcaagtccatgctgctacagcggctgcagagcctctgggcc
acgggccggctagacgcaggggtcaaattcttcttccactttcgctgccgcatgttcagc
tgcttcaaggaaagtgacaggctgtgtctgcaggacctgctcttcaagcactactgctac
ccagagcgggaccccgaggaggtgtttgccttcctgctgcgcttcccccacgtggccctc
ttcaccttcgatggcctggacgagctgcactcggacttggacctgagccgcgtgcctgac
agctcctgcccctgggagcctgcccaccccctggtcttgctggccaacctgctcagtggg
aagctgctcaagggggctagcaagctgctcacagcccgcacaggcatcgaggtcccgcgc
cagttcctgcggaagaaggtgcttctccggggcttctcccccagccacctgcgcgcctat
gccaggaggatgttccccgagcgggccctgcaggaccgcctgctgagccagctggaggcc
aaccccaacctctgcagcctgtgctctgtgcccctcttctgctggatcatcttccggtgc
ttccagcacttccgtgctgcctttgaaggctcaccacagctgcccgactgcacgatgacc
ctgacagatgtcttcctcctggtcactgaggtccatctgaacaggatgcagcccagcagc
ctggtgcagcggaacacacgcagcccagtggagaccctccacgccggccgggacactctg
tgctcgctggggcaggtggcccaccggggcatggagaagagcctctttgtcttcacccag
gaggaggtgcaggcctccgggctgcaggagagagacatgcagctgggcttcctgcgggct
ttgccggagctgggccccgggggtgaccagcagtcctatgagtttttccacctcaccctc
caggccttctttacagccttcttcctcgtgctggacgacagggtgggcactcaggagctg
ctcaggttcttccaggagtggatgccccctgcgggggcagcgaccacgtcctgctatcct
cccttcctcccgttccagtgcctgcagggcagtggtccggcgcgggaagacctcttcaag
aacaaggatcacttccagttcaccaacctcttcctgtgcgggctgttgtccaaagccaaa
cagaaactcctgcggcatctggtgcccgcggcagccctgaggagaaagcgcaaggccctg
tgggcacacctgttttccagcctgcggggctacctgaagagcctgccccgcgttcaggtc
gaaagcttcaaccaggtgcaggccatgcccacgttcatctggatgctgcgctgcatctac
gagacacagagccagaaggtggggcagctggcggccaggggcatctgcgccaactacctc
aagctgacctactgcaacgcctgctcggccgactgcagcgccctctccttcgtcctgcat
cacttccccaagcggctggccctagacctagacaacaacaatctcaacgactacggcgtg
cgggagctgcagccctgcttcagccgcctcactgttctcagactcagcgtaaaccagatc
actgacggtggggtaaaggtgctaagcgaagagctgaccaaatacaaaattgtgacctat
ttgggtttatacaacaaccagatcaccgatgtcggagccaggtacgtcaccaaaatcctg
gatgaatgcaaaggcctcacgcatcttaaactgggaaaaaacaaaataacaagtgaagga
gggaagtatctcgccctggctgtgaagaacagcaaatcaatctctgaggttgggatgtgg
ggcaatcaagttggggatgaaggagcaaaagccttcgcagaggctctgcggaaccacccc
agcttgaccaccctgagtcttgcgtccaacggcatctccacagaaggaggaaagagcctt
gcgagggccctgcagcagaacacgtctctagaaatactgtggctgacccaaaatgaactc
aacgatgaagtggcagagagtttggcagaaatgttgaaagtcaaccagacgttaaagcat
ttatggcttatccagaatcagatcacagctaaggggactgcccagctggcagatgcgtta
cagagcaacactggcataacagagatttgcctaaatggaaacctgataaaaccagaggag
gccaaagtctatgaagatgagaagcggattatctgtttctga

DBGET integrated database retrieval system