KEGG   Homo sapiens (human): 10393Help
Entry
10393             CDS       T01001                                 

Gene name
ANAPC10, APC10, DOC1
Definition
anaphase promoting complex subunit 10
Orthology
K03357  
anaphase-promoting complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10393 (ANAPC10)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10393 (ANAPC10)
   04114 Oocyte meiosis
    10393 (ANAPC10)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10393 (ANAPC10)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    10393 (ANAPC10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     10393 (ANAPC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31
AA seq 185 aa AA seqDB search
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgactacaccaaacaagacacctcctggtgctgaccccaagcagttggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtggatcagttacgagatgacaatctagaaacttattggcaatcagatggttcccag
cctcatttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgagttggtggaaccaagtggctggatt
catgttcccttaactgacaatcataagaagccaactcgtacattcatgatacagattgct
gttctagccaatcaccagaatggaagagacacccatatgagacaaattaaaatatacaca
ccagtagaagagagctccattggtaaatttcctagatgtacaactatagatttcatgatg
tatcgttcaataaggtga

DBGET integrated database retrieval system