KEGG   Homo sapiens (human): 10398Help
Entry
10398             CDS       T01001                                 

Gene name
MYL9, LC20, MLC-2C, MLC2, MRLC1, MYRL2
Definition
myosin, light chain 9, regulatory
Orthology
K12755  
myosin regulatory light chain 9
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    10398 (MYL9)
   04022 cGMP - PKG signaling pathway
    10398 (MYL9)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10398 (MYL9)
  Cellular commiunity
   04510 Focal adhesion
    10398 (MYL9)
   04530 Tight junction
    10398 (MYL9)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    10398 (MYL9)
  Endocrine system
   04921 Oxytocin signaling pathway
    10398 (MYL9)
  Circulatory system
   04270 Vascular smooth muscle contraction
    10398 (MYL9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10398 (MYL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.23
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg
attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg
ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag
gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag
gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac
gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc
cgcatcctcaaacatggcgccaaggataaagacgactag

DBGET integrated database retrieval system