KEGG   Homo sapiens (human): 10400Help
Entry
10400             CDS       T01001                                 

Gene name
PEMT, PEAMT, PEMPT, PEMT2, PNMT
Definition
phosphatidylethanolamine N-methyltransferase (EC:2.1.1.17 2.1.1.71)
Orthology
K00551  
phosphatidylethanolamine N-methyltransferase [EC:2.1.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10400 (PEMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     10400 (PEMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 214 aa AA seqDB search
MKRSGNPGAEADFCVMTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRA
FGSPYLACYSLSVTILLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVL
SSFFALGFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLL
TVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatctgggaacccgggagccgaggcagacttctgcgttatgacccggctgctg
ggctacgtggaccccctggatcccagctttgtggctgccgtcatcaccatcaccttcaat
ccgctctactggaatgtggttgcacgatgggaacacaagacccgcaagctgagcagggcc
ttcggatccccctacctggcctgctactctctaagcgtcaccatcctgctcctgaacttc
ctgcgctcgcactgcttcacgcaggccatgctgagccagcccaggatggagagcctggac
acccccgcggcctacagcctgggcctcgcgctcctgggactgggcgtcgtgctcgtgctc
tccagcttctttgcactggggttcgctggaactttcctaggtgattacttcgggatcctc
aaggaggcgagagtgaccgtgttccccttcaacatcctggacaaccccatgtactgggga
agcacagccaactacctgggctgggccatcatgcacgccagccccacgggcctgctcctg
acggtgctggtggccctcacctacatagtggctctcctatacgaagagcccttcaccgct
gagatctaccggcagaaagcctccgggtcccacaagaggagctga

DBGET integrated database retrieval system