KEGG   Homo sapiens (human): 10401Help
Entry
10401             CDS       T01001                                 

Gene name
PIAS3, ZMIZ5
Definition
protein inhibitor of activated STAT, 3
Orthology
K16064  
E3 SUMO-protein ligase PIAS3 [EC:6.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Jak-STAT signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 628 aa AA seqDB search
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gctctgcacctcctgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaacgctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctatggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggccgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaactcagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcctacatggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggggggagatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacatctggccaccagccatcctcggtgctaaggagccctgctatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgacatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctctgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgctggggagctcc
cactgcagcgccactccggcgccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system