KEGG   Homo sapiens (human): 10401Help
Entry
10401             CDS       T01001                                 

Gene name
PIAS3, ZMIZ5
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10401 (PIAS3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    10401 (PIAS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   10401 (PIAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Motif
Other DBs
NCBI-GeneID: 10401
NCBI-ProteinID: NP_006090
OMIM: 605987
HGNC: 16861
Ensembl: ENSG00000131788
Vega: OTTHUMG00000013750
Pharos: Q9Y6X2(Tbio)
UniProt: Q9Y6X2 B3KNI3
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 628 aa AA seqDB search
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gctctgcacctcctgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaacgctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctatggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggccgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaactcagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcctacatggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggggggagatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacatctggccaccagccatcctcggtgctaaggagccctgctatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgacatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctctgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgctggggagctcc
cactgcagcgccactccggcgccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system