KEGG   Homo sapiens (human): 10406Help
Entry
10406             CDS       T01001                                 

Gene name
WFDC2, EDDM4, HE4, WAP5, dJ461P17.6
Definition
WAP four-disulfide core domain 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.12
AA seq 124 aa AA seqDB search
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLK
CCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV
TPNF
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcttgtcgcctaggcccgctagccgccgccctcctcctcagcctgctgctgttc
ggcttcaccctagtctcaggcacaggagcagagaagactggcgtgtgccccgagctccag
gctgaccagaactgcacgcaagagtgcgtctcggacagcgaatgcgccgacaacctcaag
tgctgcagcgcgggctgtgccaccttctgctctctgcccaatgataaggagggttcctgc
ccccaggtgaacattaactttccccagctcggcctctgtcgggaccagtgccaggtggac
agccagtgtcctggccagatgaaatgctgccgcaatggctgtgggaaggtgtcctgtgtc
actcccaatttctga

DBGET integrated database retrieval system