KEGG   Homo sapiens (human): 10411Help
Entry
10411             CDS       T01001                                 

Gene name
RAPGEF3, CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
Definition
Rap guanine nucleotide exchange factor (GEF) 3
Orthology
K08014  
Rap guanine nucleotide exchange factor 3
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Leukocyte transendothelial migration
Long-term potentiation
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    10411 (RAPGEF3)
   04024 cAMP signaling pathway
    10411 (RAPGEF3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    10411 (RAPGEF3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10411 (RAPGEF3)
  Nervous system
   04726 Serotonergic synapse
    10411 (RAPGEF3)
   04720 Long-term potentiation
    10411 (RAPGEF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.1
AA seq 923 aa AA seqDB search
MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggctggccaggtgagagctgctggcaggtgggcctggctgtggaggatagc
ccagctctgggagcaccgcgggtgggagccctccctgacgtggtgccggaggggacacta
ctcaacatggtgttgagaaggatgcaccggccccgaagctgctcctaccagctgctgctg
gagcaccagcgtccgagctgcatccaggggctgcgctggacaccactcaccaacagcgag
gagtccctggatttcagcgagagcctggagcaggcctccacagagcgggtgctcagggct
gggaggcagctgcatcggcatctgctggccacctgcccaaacctcatccgagaccggaag
taccaccttaggctctatcggcagtgctgctctggccgggagctggtggatgggatcttg
gccctgggacttggggtccattcccggagccaagttgtgggaatctgccaggtgctgctg
gatgaaggtgccctctgccatgtgaaacacgactgggccttccaggaccgagatgcccaa
ttctaccggttccccgggcccgagcccgagcccgtgggaactcatgagatggaggaggag
ttggccgaagctgtggccctgctctcccagcgggggcctgacgccctgctcactgtggca
cttcgaaagcccccaggtcagcgcacggatgaagagctggacctcatctttgaggagctg
ctgcacatcaaggctgtggcccacctctccaactcggtgaagcgagaattagcggctgtt
ctgctctttgaaccacacagcaaggcagggaccgtgttgttcagccagggggacaagggc
acttcgtggtacattatctggaagggatctgtcaacgtggtgacccatggcaaggggctg
gtgaccaccctgcatgagggagatgattttggacagctggctctggtgaatgatgcaccc
cgggcagccaccatcatcctgcgagaagacaactgtcatttcctgcgtgtggacaagcag
gacttcaaccgtatcatcaaggatgtggaggcaaagaccatgcggctggaagaacatggc
aaagtggtgctggtgctggagagagcctctcagggcgccggcccttcccgacccccaacc
ccaggcaggaaccggtatacagtgatgtctggcaccccagagaagatcctagagcttctg
ttggaggccatgggaccagattccagtgctcatgacccaacagagacattcctcagcgac
ttcctcctgacccacagggtcttcatgcccagcgcccaactctgcgctgcccttctgcac
cacttccatgtggagcctgcgggtggcagcgagcaggagcgcagcacctacgtctgcaac
aagaggcagcagatcttgcggctggtcagccagtgggtggccctgtatggctccatgctc
cacactgaccctgtggccaccagcttcctccagaaactctcagacctggtgggcagggac
acccgactcagcaacctgctgagggagcagtggccagagaggcggcgatgccacaggttg
gagaatggctgtgggaatgcatctcctcagatgaaggcccggaacttgcctgtttggctc
cccaaccaggacgagccccttcctggcagcagctgtgccatccaagttggggataaagtc
ccctatgacatctgccggccagaccactcagtgttgaccctgcagctgcctgtgacagcc
tccgtgagagaggtgatggcagcgttggcccaggaggatggctggaccaaggggcaggtg
ctggtgaaggtcaattctgcaggtgatgccattggcctgcagccagatgcccgtggtgtg
gccacatctctggggctcaatgagcgtctctttgttgtcaacccacaggaagtgcatgag
ctgatcccacaccctgaccagctggggcccactgtgggctctgctgaggggctggacctg
gtgagtgccaaggacctggcaggccagctgacggaccacgactggagcctcttcaacagt
atccaccaggtggagctgatccactatgtgctgggcccccagcatctgcgggatgtcacc
accgccaacctggagcgcttcatgcgccgcttcaatgagctgcagtactgggtggccacc
gagctgtgtctctgccccgtgcccggcccccgggcccagctgctcaggaagttcattaag
ctggcggcccacctcaaggagcagaagaatctcaattccttctttgccgtcatgtttggc
ctcagcaactcggccatcagccgcctagcccacacctgggagcggctgcctcacaaagtc
cggaagctgtactccgccctcgagaggctgctggatccctcatggaaccaccgggtatac
cgactggccctcgccaagctctcccctcctgtcatccccttcatgccccttcttctcaaa
gacatgaccttcattcatgagggaaaccacacactagtggagaatctcatcaactttgag
aagatgagaatgatggccagagccgcgcggatgctgcaccactgccgaagccacaaccct
gtgcctctctcaccactcagaagccgagtttcccacctccacgaggacagccaggtggcg
aggatttccacatgctcggagcagtccctgagcacccggagtccagccagcacctgggct
tatgtccagcagctgaaggtcattgacaaccagcgggaactctcccgcctctcccgagag
ctggagccatga

DBGET integrated database retrieval system