KEGG   Homo sapiens (human): 10411Help
Entry
10411             CDS       T01001                                 

Gene name
RAPGEF3, CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
Definition
Rap guanine nucleotide exchange factor (GEF) 3
Orthology
K08014  
Rap guanine nucleotide exchange factor 3
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Adrenergic signaling in cardiomyocytes
Leukocyte transendothelial migration
Long-term potentiation
Serotonergic synapse
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.1
AA seq 923 aa AA seqDB search
MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggctggccaggtgagagctgctggcaggtgggcctggctgtggaggatagc
ccagctctgggagcaccgcgggtgggagccctccctgacgtggtgccggaggggacacta
ctcaacatggtgttgagaaggatgcaccggccccgaagctgctcctaccagctgctgctg
gagcaccagcgtccgagctgcatccaggggctgcgctggacaccactcaccaacagcgag
gagtccctggatttcagcgagagcctggagcaggcctccacagagcgggtgctcagggct
gggaggcagctgcatcggcatctgctggccacctgcccaaacctcatccgagaccggaag
taccaccttaggctctatcggcagtgctgctctggccgggagctggtggatgggatcttg
gccctgggacttggggtccattcccggagccaagttgtgggaatctgccaggtgctgctg
gatgaaggtgccctctgccatgtgaaacacgactgggccttccaggaccgagatgcccaa
ttctaccggttccccgggcccgagcccgagcccgtgggaactcatgagatggaggaggag
ttggccgaagctgtggccctgctctcccagcgggggcctgacgccctgctcactgtggca
cttcgaaagcccccaggtcagcgcacggatgaagagctggacctcatctttgaggagctg
ctgcacatcaaggctgtggcccacctctccaactcggtgaagcgagaattagcggctgtt
ctgctctttgaaccacacagcaaggcagggaccgtgttgttcagccagggggacaagggc
acttcgtggtacattatctggaagggatctgtcaacgtggtgacccatggcaaggggctg
gtgaccaccctgcatgagggagatgattttggacagctggctctggtgaatgatgcaccc
cgggcagccaccatcatcctgcgagaagacaactgtcatttcctgcgtgtggacaagcag
gacttcaaccgtatcatcaaggatgtggaggcaaagaccatgcggctggaagaacatggc
aaagtggtgctggtgctggagagagcctctcagggcgccggcccttcccgacccccaacc
ccaggcaggaaccggtatacagtgatgtctggcaccccagagaagatcctagagcttctg
ttggaggccatgggaccagattccagtgctcatgacccaacagagacattcctcagcgac
ttcctcctgacccacagggtcttcatgcccagcgcccaactctgcgctgcccttctgcac
cacttccatgtggagcctgcgggtggcagcgagcaggagcgcagcacctacgtctgcaac
aagaggcagcagatcttgcggctggtcagccagtgggtggccctgtatggctccatgctc
cacactgaccctgtggccaccagcttcctccagaaactctcagacctggtgggcagggac
acccgactcagcaacctgctgagggagcagtggccagagaggcggcgatgccacaggttg
gagaatggctgtgggaatgcatctcctcagatgaaggcccggaacttgcctgtttggctc
cccaaccaggacgagccccttcctggcagcagctgtgccatccaagttggggataaagtc
ccctatgacatctgccggccagaccactcagtgttgaccctgcagctgcctgtgacagcc
tccgtgagagaggtgatggcagcgttggcccaggaggatggctggaccaaggggcaggtg
ctggtgaaggtcaattctgcaggtgatgccattggcctgcagccagatgcccgtggtgtg
gccacatctctggggctcaatgagcgtctctttgttgtcaacccacaggaagtgcatgag
ctgatcccacaccctgaccagctggggcccactgtgggctctgctgaggggctggacctg
gtgagtgccaaggacctggcaggccagctgacggaccacgactggagcctcttcaacagt
atccaccaggtggagctgatccactatgtgctgggcccccagcatctgcgggatgtcacc
accgccaacctggagcgcttcatgcgccgcttcaatgagctgcagtactgggtggccacc
gagctgtgtctctgccccgtgcccggcccccgggcccagctgctcaggaagttcattaag
ctggcggcccacctcaaggagcagaagaatctcaattccttctttgccgtcatgtttggc
ctcagcaactcggccatcagccgcctagcccacacctgggagcggctgcctcacaaagtc
cggaagctgtactccgccctcgagaggctgctggatccctcatggaaccaccgggtatac
cgactggccctcgccaagctctcccctcctgtcatccccttcatgccccttcttctcaaa
gacatgaccttcattcatgagggaaaccacacactagtggagaatctcatcaactttgag
aagatgagaatgatggccagagccgcgcggatgctgcaccactgccgaagccacaaccct
gtgcctctctcaccactcagaagccgagtttcccacctccacgaggacagccaggtggcg
aggatttccacatgctcggagcagtccctgagcacccggagtccagccagcacctgggct
tatgtccagcagctgaaggtcattgacaaccagcgggaactctcccgcctctcccgagag
ctggagccatga

DBGET integrated database retrieval system