KEGG   Homo sapiens (human): 10417Help
Entry
10417             CDS       T01001                                 

Gene name
SPON2, DIL-1, DIL1, M-SPONDIN, MINDIN
Definition
(RefSeq) spondin 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Spond_N TSP_1
Motif
Other DBs
NCBI-GeneID: 10417
NCBI-ProteinID: NP_001121797
OMIM: 605918
HGNC: 11253
Ensembl: ENSG00000159674
Vega: OTTHUMG00000089002
Pharos: Q9BUD6(Tbio)
UniProt: Q9BUD6
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 331 aa AA seqDB search
MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccccagcccggccgccgccctgggcaaggccctctgcgctctcctcctggcc
actctcggcgccgccggccagcctcttgggggagagtccatctgttccgccagagccccg
gccaaatacagcatcaccttcacgggcaagtggagccagacggccttccccaagcagtac
cccctgttccgcccccctgcgcagtggtcttcgctgctgggggccgcgcatagctccgac
tacagcatgtggaggaagaaccagtacgtcagtaacgggctgcgcgactttgcggagcgc
ggcgaggcctgggcgctgatgaaggagatcgaggcggcgggggaggcgctgcagagcgtg
cacgcggtgttttcggcgcccgccgtccccagcggcaccgggcagacgtcggcggagctg
gaggtgcagcgcaggcactcgctggtctcgtttgtggtgcgcatcgtgcccagccccgac
tggttcgtgggcgtggacagcctggacctgtgcgacggggaccgttggcgggaacaggcg
gcgctggacctgtacccctacgacgccgggacggacagcggcttcaccttctcctccccc
aacttcgccaccatcccgcaggacacggtgaccgagataacgtcctcctctcccagccac
ccggccaactccttctactacccgcggctgaaggccctgcctcccatcgccagggtgaca
ctggtgcggctgcgacagagccccagggccttcatccctcccgccccagtcctgcccagc
agggacaatgagattgtagacagcgcctcagttccagaaacgccgctggactgcgaggtc
tccctgtggtcgtcctggggactgtgcggaggccactgtgggaggctcgggaccaagagc
aggactcgctacgtccgggtccagcccgccaacaacgggagcccctgccccgagctcgaa
gaagaggctgagtgcgtccctgataactgcgtctaa

DBGET integrated database retrieval system