KEGG   Homo sapiens (human): 10417Help
Entry
10417             CDS       T01001                                 

Gene name
SPON2, DIL-1, DIL1, M-SPONDIN, MINDIN
Definition
spondin 2, extracellular matrix protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 331 aa AA seqDB search
MENPSPAAALGKALCALLLATLGAAGQPLGGESICSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccccagcccggccgccgccctgggcaaggccctctgcgctctcctcctggcc
actctcggcgccgccggccagcctcttgggggagagtccatctgttccgccagagccccg
gccaaatacagcatcaccttcacgggcaagtggagccagacggccttccccaagcagtac
cccctgttccgcccccctgcgcagtggtcttcgctgctgggggccgcgcatagctccgac
tacagcatgtggaggaagaaccagtacgtcagtaacgggctgcgcgactttgcggagcgc
ggcgaggcctgggcgctgatgaaggagatcgaggcggcgggggaggcgctgcagagcgtg
cacgcggtgttttcggcgcccgccgtccccagcggcaccgggcagacgtcggcggagctg
gaggtgcagcgcaggcactcgctggtctcgtttgtggtgcgcatcgtgcccagccccgac
tggttcgtgggcgtggacagcctggacctgtgcgacggggaccgttggcgggaacaggcg
gcgctggacctgtacccctacgacgccgggacggacagcggcttcaccttctcctccccc
aacttcgccaccatcccgcaggacacggtgaccgagataacgtcctcctctcccagccac
ccggccaactccttctactacccgcggctgaaggccctgcctcccatcgccagggtgaca
ctggtgcggctgcgacagagccccagggccttcatccctcccgccccagtcctgcccagc
agggacaatgagattgtagacagcgcctcagttccagaaacgccgctggactgcgaggtc
tccctgtggtcgtcctggggactgtgcggaggccactgtgggaggctcgggaccaagagc
aggactcgctacgtccgggtccagcccgccaacaacgggagcccctgccccgagctcgaa
gaagaggctgagtgcgtccctgataactgcgtctaa

DBGET integrated database retrieval system