KEGG   Homo sapiens (human): 10420Help
Entry
10420             CDS       T01001                                 

Gene name
TESK2
Definition
testis-specific kinase 2 (EC:2.7.12.1)
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32
AA seq 571 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGLQTQGKQDG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgaa
gagtttgaaggaggtggtggaggagaaggaaatgtgagccaggtgggaagagtttggcca
tcttcgtatcgagctcttataagtgccttttccagactgacgcgtttggatgatttcacc
tgtgaaaaaatagggtctggcttcttttctgaagtgttcaaggtacgacaccgagcttct
ggtcaggtgatggctcttaagatgaacacattgagcagtaaccgggcaaacatgctgaaa
gaagtacagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtatgt
gttcatcaaggacaattgcatgcacttacagagtatatcaactccgggaacctggaacag
ttgctagacagtaacctgcatttgccttggactgtgagggtaaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccccgatgtcagcatggggagtgagaagctggccgtggtgggttcccca
ttctggatggcacctgaggttctccgagatgagccctataatgaaaaggcagatgtgttc
tcttatggtatcatcctctgcgagatcatcgcccgcatccaggccgatccggactatctt
ccccgcacagagaatttcgggctggactatgatgctttccagcacatggtgggagactgt
cccccagattttctgcaacttactttcaactgctgtaacatggatcccaaactgcgccca
tcttttgtggagattgggaagaccctggaggaaattctgagccgcctacaggaagaagag
caggagagggataggaagctgcagcccacagccaggggactcttggagaaagcacctggg
gtgaagcgactaagctcactggatgacaagatcccccacaagtcaccatgcccaagacgt
accatctggctgtctcgaagccagtcagatatcttttcccgtaagcccccacgtacagtg
agtgtcttggacccatactaccggccacgagatggtgctgcccgcacccccaaagtcaac
ccttttagtgctcgccaggacctcatggggggcaagatcaagttttttgacctgcccagc
aagtctgtcatctctctggtatttgacctggatgcaccagggcccggaactatgcccctg
gctgactggcaggagcccctggccccacctattcgccggtggcgttccttgcctggttcg
cctgagttcttgcatcaagaggcttgtccatttgtgggccgggaagaatcgctatctgat
gggcccccaccacgcctaagtagtctcaagtacagagttaaagagatcccaccattccgg
gcatctgccctaccagctgctcaagcccatgaggctatggactgctccattctccaggaa
gaaaatggttttgggtccaggccccaggggaccagtccatgccctgcgggtgcttctgag
gagatggaggtagaagaaaggccagcaggctcaactccagccaccttctccacctcaggc
ataggcctgcaaacccagggaaagcaggatgggtga

DBGET integrated database retrieval system