KEGG   Homo sapiens (human): 10421Help
Entry
10421             CDS       T01001                                 

Gene name
CD2BP2, FWP010, LIN1, PPP1R59, Snu40, U5-52K
Definition
(RefSeq) CD2 (cytoplasmic tail) binding protein 2
  KO
K13099  
CD2 antigen cytoplasmic tail-binding protein 2
Organism
hsa  Homo sapiens (human)
Module
Spliceosome, U4/U6.U5 tri-snRNP
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10421 (CD2BP2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    10421 (CD2BP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 341 aa AA seqDB search
MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGS
SKYDILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWL
DNIDWVKIRERPPGQRQASDSEEEDSLGQTSMSAQALLEGLLELLLPRETVAGALRRLGA
RGGGKGRKGPGQPSSPQRLDRLSGLADQMVARGNLGVYQETRERLAMRLKGLGCQTLGPH
NPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFT
SAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaggaaagtgaccttccaaggcgtgggagatgaggaggatgaggatgaaatc
attgtccccaagaagaagctggtggaccctgtggctgggtcagggggtcctgggagccgc
tttaaaggcaaacactctttggatagcgatgaggaggaggatgatgatgatggggggtcc
agcaaatatgacatcttggcctcagaggatgtagaaggtcaggaggcagccacactcccc
agcgaggggggtgttcggatcacaccctttaacctgcaggaggagatggaggaaggccac
tttgatgccgatggcaactacttcctgaaccgggatgctcagatccgagacagctggctg
gacaacattgactgggtgaagatccgggagcggccacctggccagcgccaggcctcagac
tcggaggaggaggacagcttgggccagacctcaatgagtgcccaagccctcttggaggga
cttttggagctcctattgcctagagagacagtggctggggcactgaggcgtctgggggcc
cgaggaggaggcaaagggagaaaggggcctgggcaacccagttcccctcagcgcctggac
cggctctccgggttggccgaccagatggtggcccggggcaaccttggtgtgtaccaggaa
acaagggaacggttggctatgcgtctgaagggtttggggtgtcagaccctaggaccccac
aatcccacacccccaccctccctggacatgttcgctgaggagttggcggaggaggaactg
gagaccccaacccctacccagagaggagaagcagagtcgcggggagatggtctggtggat
gtgatgtgggaatataagtgggagaacacgggggatgccgagctgtatgggcccttcacc
agcgcccagatgcagacctgggtgagtgaaggctacttcccggacggtgtttattgccgg
aagctggacccccctggtggtcagttctacaactccaaacgcattgactttgacctctac
acctga

DBGET integrated database retrieval system