KEGG   Homo sapiens (human): 10426Help
Entry
10426             CDS       T01001                                 

Gene name
TUBGCP3, 104p, GCP3, Grip104, SPBC98, Spc98, Spc98p
Definition
(RefSeq) tubulin gamma complex associated protein 3
  KO
K16570  
gamma-tubulin complex component 3
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    gamma-tubulin ring complex
     10426 (TUBGCP3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     10426 (TUBGCP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10426 (TUBGCP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q34
AA seq 907 aa AA seqDB search
MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKK
ELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQ
ALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSL
LPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTG
GTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWL
HNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLES
SLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILS
LVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQS
RKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFE
TSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGI
LETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHY
LRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQY
YITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFD
QIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESI
PKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTR
GRRSSHT
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccggaccagaagtcgccgaacgttctgctgcagaacctgtgctgcaggatc
ctgggcaggagcgaagctgatgtagcccagcagttccagtatgctgtgcgggtgattggc
agcaacttcgccccaactgttgaaagagatgaatttttagtagctgaaaaaatcaagaaa
gagcttattcgacaacgaagagaagcagatgctgcattattttcagaactccacagaaaa
cttcattcacagggagttttgaaaaataaatggtcaatactctacctcttgctgagcctc
agtgaggacccacgcaggcagccaagcaaggtttctagctatgctacgttatttgctcag
gccttaccaagagatgcccactcaaccccttactactatgccaggcctcagacccttccc
ctgagctaccaagatcggagtgcccagtcagcccagagctccggcagcgtgggcagcagt
ggcatcagcagcattggcctgtgtgccctcagtggccccgcgcctgcgccacaatctctc
ctcccaggacagtctaatcaagctccaggagtaggagattgccttcgacagcagttgggg
tcacgactcgcatggactttaactgcaaatcagccttcttcacaagccactacctcaaaa
ggtgtccccagtgctgtgtctcgcaacatgacaaggtccaggagagaaggggatacgggt
ggtactatggaaattacagaagcagctctggtaagggacattttgtacgtctttcagggc
atagatggcaaaaacatcaaaatgaacaacactgaaaattgttacaaagtagaaggaaag
gcaaatctaagtaggtctttgagagacacagcagtcaggctttctgagttgggatggttg
cataataaaatcagaagatacacggaccagaggagcctggaccgctcattcggactcgtc
gggcagagcttttgtgctgccttgcaccaggaactcagagaatactatcgattgctctct
gttttacattctcagctacaactagaggatgaccagggtgtgaatttgggacttgagagt
agtttaacacttcggcgcctcctggtttggacctatgatcccaaaatacgactgaagacc
cttgcggccctagtggaccactgccaaggaaggaaaggaggtgagctggcctcagctgtc
cacgcctacacaaaaacaggagacccgtacatgcggtctctggtgcagcacatcctcagc
ctcgtgtctcatcctgttttgagcttcctgtaccgctggatatatgatggggagcttgag
gacacttaccacgaattttttgtagcatcagatccaacagttaaaacagatcgactgtgg
cacgacaagtatactttgaggaaatcgatgattccttcgtttatgacgatggatcagtct
aggaaggtccttttgataggaaaatcaataaatttcttgcaccaagtttgtcatgatcag
actcccactacaaagatgatagctgtgaccaagtctgcagagtcaccccaggacgctgca
gacctattcacagacttggaaaatgcatttcaggggaagattgatgctgcttattttgag
accagcaaatacctgttggatgttctcaataaaaagtacagcttgctggaccacatgcag
gcaatgaggcggtacctgcttcttggtcaaggagactttataaggcacttaatggacttg
ctaaaaccagaacttgtccgtccagctacgactttgtatcagcataacttgactggaatt
ctagaaaccgctgtcagagccaccaacgcacagtttgacagtcctgagatcctgcgaagg
ctggacgtgcggctgctggaggtctctccaggtgacactggatgggatgtcttcagcctc
gattatcatgttgacggaccaattgcaactgtgtttactcgagaatgtatgagccactac
ctaagagtatttaacttcctctggagggcgaagcggatggaatacatcctcactgacata
cggaagggacacatgtgcaatgcaaagctcctgagaaacatgccagagttctccggggtg
ctgcaccagtgtcacattttggcctctgagatggtccatttcattcatcagatgcagtat
tacatcacatttgaggtgcttgaatgttcttgggatgagctttggaacaaagtccagcag
gcccaggatttggatcacatcattgctgcacacgaggtgttcttagacaccatcatctcc
cgctgcctgctggacagtgactccagggcacttttaaatcaacttagagctgtgtttgat
caaattattgaacttcagaatgctcaagatgcaatatacagagctgctctggaagaattg
cagagacgattacagtttgaagagaaaaagaaacagcgtgaaattgagggccagtgggga
gtgacggcagcagaggaagaggaggaaaataagaggattggagaatttaaagaatctata
ccaaaaatgtgctcacagttgcgaatattgacccatttctaccagggtatcgtgcagcag
tttttggtgttactgacgaccagctctgacgagagtcttcggtttcttagcttcaggctg
gacttcaacgagcattacaaagccagggagcccaggctccgtgtgtctctgggtaccagg
gggcggcgcagctcccacacgtga

DBGET integrated database retrieval system