KEGG   Homo sapiens (human): 10434Help
Entry
10434             CDS       T01001                                 

Gene name
LYPLA1, APT-1, APT1, LPL-I, LPL1, hAPT1
Definition
(RefSeq) lysophospholipase I
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10434 (LYPLA1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    10434 (LYPLA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     10434 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 Cutinase FSH1 DUF2974 DLH Esterase Lipase_3 DUF2920
Motif
Other DBs
NCBI-GeneID: 10434
NCBI-ProteinID: NP_006321
OMIM: 605599
HGNC: 6737
Ensembl: ENSG00000120992
Vega: OTTHUMG00000164313
Pharos: O75608(Tchem)
UniProt: O75608 Q6IAQ1
Structure
PDB: 

Jmol
Position
8q11.23
AA seq 230 aa AA seqDB search
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctgcccgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacgtggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggaggagctttatctttatatactgcccttaccacacagcagaaactggcaggtgtcact
gcactcagttgctggcttccacttcgggcttcctttccacagggtcctatcggtggtgct
aatagagatatttctattctccagtgccacggggattgtgaccctttggttcccctgatg
tttggttctcttacggtggaaaaactaaaaacattggtgaatccagccaatgtgaccttt
aaaacctatgaaggtatgatgcacagttcgtgtcaacaggaaatgatggatgtcaagcaa
ttcattgataaactcctacctccaattgattga

DBGET integrated database retrieval system