KEGG   Homo sapiens (human): 10434Help
Entry
10434             CDS       T01001                                 

Gene name
LYPLA1, APT-1, APT1, LPL-I, LPL1, hAPT1
Definition
lysophospholipase I (EC:3.1.1.5 3.1.2.-)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11.23
AA seq 196 aa AA seqDB search
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQE
MMDVKQFIDKLLPPID
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctgcccgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacgtggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggtcctatcggtggtgctaatagagatatttctattctccagtgccacggggattgtgac
cctttggttcccctgatgtttggttctcttacggtggaaaaactaaaaacattggtgaat
ccagccaatgtgacctttaaaacctatgaaggtatgatgcacagttcgtgtcaacaggaa
atgatggatgtcaagcaattcattgataaactcctacctccaattgattga

DBGET integrated database retrieval system