KEGG   Homo sapiens (human): 10434Help
Entry
10434             CDS       T01001                                 

Gene name
LYPLA1, APT-1, APT1, LPL-I, LPL1, hAPT1
Definition
lysophospholipase I (EC:3.1.1.5 3.1.2.-)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10434 (LYPLA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     10434 (LYPLA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11.23
AA seq 196 aa AA seqDB search
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQE
MMDVKQFIDKLLPPID
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctgcccgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacgtggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggtcctatcggtggtgctaatagagatatttctattctccagtgccacggggattgtgac
cctttggttcccctgatgtttggttctcttacggtggaaaaactaaaaacattggtgaat
ccagccaatgtgacctttaaaacctatgaaggtatgatgcacagttcgtgtcaacaggaa
atgatggatgtcaagcaattcattgataaactcctacctccaattgattga

DBGET integrated database retrieval system