KEGG   Homo sapiens (human): 10437Help
Entry
10437             CDS       T01001                                 

Gene name
IFI30, GILT, IFI-30, IP-30, IP30
Definition
(RefSeq) IFI30, lysosomal thiol reductase
  KO
K08059  
interferon, gamma-inducible protein 30
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    10437 (IFI30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P13284(Tbio)
UniProt: 
Position
19p13.11
AA seq 250 aa AA seqDB search
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAP
LVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHG
EEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM
GDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSS
TSSLRSVCFK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtcgccacttctgctgttcctgccaccgctgctgctgctgctggacgtcccc
acggcggcggtgcaggcgtcccctctgcaagcgttagacttctttgggaatgggccacca
gttaactacaagacaggcaatctatacctgcgggggcccctgaagaagtccaatgcaccg
cttgtcaatgtgaccctctactatgaagcactgtgcggtggctgccgagccttcctgatc
cgggagctcttcccaacatggctgttggtcatggagatcctcaatgtcacgctggtgccc
tacggaaacgcacaggaacaaaatgtcagtggcaggtgggagttcaagtgccagcatgga
gaagaggagtgcaaattcaacaaggtggaggcctgcgtgttggatgaacttgacatggag
ctagccttcctgaccattgtctgcatggaagagtttgaggacatggagagaagtctgcca
ctatgcctgcagctctacgccccagggctgtcgccagacactatcatggagtgtgcaatg
ggggaccgcggcatgcagctcatgcacgccaacgcccagcggacagatgctctccagcca
ccacacgagtatgtgccctgggtcaccgtcaatgggaaacccttggaagatcagacccag
ctccttacccttgtctgccagttgtaccagggcaagaagccggatgtctgcccttcctca
accagctccctcaggagtgtttgcttcaagtga

DBGET integrated database retrieval system