KEGG   Homo sapiens (human): 10438Help
Entry
10438             CDS       T01001                                 

Gene name
C1D, LRP1, SUN-CoR, SUNCOR, hC1D
Definition
C1D nuclear receptor corepressor
Orthology
K12592  
exosome complex protein LRP1
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    10438 (C1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2p13-p12
AA seq 141 aa AA seqDB search
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKN
ALWEPKSKNASKVANKGKSKS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgaagaaattaatgaagactatccagtagaaattcacgagtatttgtcagcg
tttgagaattccattggtgctgtggatgagatgctgaagaccatgatgtctgtttctaga
aatgagttgttgcagaagttggatccacttgaacaagcaaaagtggatttggtttctgca
tacacattaaattcaatgttttgggtttatttggcaacccaaggagttaatcctaaggaa
catccagtaaaacaggaattggaaagaatcagagtatatatgaacagagtcaaggaaata
acagacaagaaaaaggctggcaagctggacagaggtgcagcttcaagatttgtaaaaaat
gccctctgggaaccaaaatcgaaaaatgcatcaaaagttgccaataaaggaaaaagtaaa
agttaa

DBGET integrated database retrieval system