KEGG   Homo sapiens (human): 10449Help
Entry
10449             CDS       T01001                                 

Gene name
ACAA2, DSAEC
Definition
(RefSeq) acetyl-CoA acyltransferase 2
  KO
K07508  
acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    10449 (ACAA2)
   00071 Fatty acid degradation
    10449 (ACAA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    10449 (ACAA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     10449 (ACAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P42765(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.1
AA seq 397 aa AA seqDB search
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctccgaggtgtgtttgtagttgctgctaagcgaacgccctttggagcttac
ggaggccttctgaaagacttcactgctactgacttgtctgaatttgctgccaaggctgcc
ttgtctgctggcaaagtctcacctgaaacagttgacagtgtgattatgggcaatgtcctg
cagagttcttcagatgctatatatttggcaaggcatgttggtttgcgtgtgggaatccca
aaggagaccccagctctcacgattaataggctctgtggttctggttttcagtccattgtg
aatggatgtcaggaaatttgtgttaaagaagctgaagttgttttatgtggaggaaccgaa
agcatgagccaagctccctactgtgtcagaaatgtgcgttttggaaccaagcttggatca
gatatcaagctggaagattctttatgggtatcattaacagatcagcatgtccagctcccc
atggcaatgactgcagagaatcttgctgtaaaacacaaaataagcagagaagaatgtgac
aaatatgccctgcagtcacagcagagatggaaagctgctaatgatgctggctactttaat
gatgaaatggcaccaattgaagtgaagacaaagaaaggaaaacagacaatgcaggtagac
gagcatgctcggccccaaaccaccctggaacagttacagaaacttcctccagtattcaag
aaagatggaactgttactgcagggaatgcatcgggtgtagctgatggtgctggagctgtt
atcatagctagtgaagatgctgttaagaaacataacttcacaccactggcaagaattgtg
ggctactttgtatctggatgtgatccctctatcatgggtattggtcctgtccctgctatc
agtggggcactgaagaaagcaggactgagtcttaaggacatggatttggtagaggtgaat
gaagcttttgctccccagtacttggctgttgagaggagtttggatcttgacataagtaaa
accaatgtgaatggaggagccattgctttgggtcacccactgggaggatctggatcaaga
attactgcacacctggttcacgaattaaggcgtcgaggtggaaaatatgccgttggatca
gcttgcattggaggtggccaaggtattgctgtcatcattcagagcacagcctga

DBGET integrated database retrieval system