KEGG   Homo sapiens (human): 10449Help
Entry
10449             CDS       T01001                                 

Gene name
ACAA2, DSAEC
Definition
acetyl-CoA acyltransferase 2 (EC:2.3.1.16)
Orthology
K07508  
acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    10449 (ACAA2)
  Lipid metabolism
   00062 Fatty acid elongation
    10449 (ACAA2)
   00071 Fatty acid degradation
    10449 (ACAA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    10449 (ACAA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     10449 (ACAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 397 aa AA seqDB search
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctccgaggtgtgtttgtagttgctgctaagcgaacgccctttggagcttac
ggaggccttctgaaagacttcactgctactgacttgtctgaatttgctgccaaggctgcc
ttgtctgctggcaaagtctcacctgaaacagttgacagtgtgattatgggcaatgtcctg
cagagttcttcagatgctatatatttggcaaggcatgttggtttgcgtgtgggaatccca
aaggagaccccagctctcacgattaataggctctgtggttctggttttcagtccattgtg
aatggatgtcaggaaatttgtgttaaagaagctgaagttgttttatgtggaggaaccgaa
agcatgagccaagctccctactgtgtcagaaatgtgcgttttggaaccaagcttggatca
gatatcaagctggaagattctttatgggtatcattaacagatcagcatgtccagctcccc
atggcaatgactgcagagaatcttgctgtaaaacacaaaataagcagagaagaatgtgac
aaatatgccctgcagtcacagcagagatggaaagctgctaatgatgctggctactttaat
gatgaaatggcaccaattgaagtgaagacaaagaaaggaaaacagacaatgcaggtagac
gagcatgctcggccccaaaccaccctggaacagttacagaaacttcctccagtattcaag
aaagatggaactgttactgcagggaatgcatcgggtgtagctgatggtgctggagctgtt
atcatagctagtgaagatgctgttaagaaacataacttcacaccactggcaagaattgtg
ggctactttgtatctggatgtgatccctctatcatgggtattggtcctgtccctgctatc
agtggggcactgaagaaagcaggactgagtcttaaggacatggatttggtagaggtgaat
gaagcttttgctccccagtacttggctgttgagaggagtttggatcttgacataagtaaa
accaatgtgaatggaggagccattgctttgggtcacccactgggaggatctggatcaaga
attactgcacacctggttcacgaattaaggcgtcgaggtggaaaatatgccgttggatca
gcttgcattggaggtggccaaggtattgctgtcatcattcagagcacagcctga

DBGET integrated database retrieval system