KEGG   Homo sapiens (human): 10449Help
Entry
10449             CDS       T01001                                 

Gene name
ACAA2, DSAEC
Definition
acetyl-CoA acyltransferase 2 (EC:2.3.1.16)
Orthology
K07508  
acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 397 aa AA seqDB search
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL
QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD
KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctccgaggtgtgtttgtagttgctgctaagcgaacgccctttggagcttac
ggaggccttctgaaagacttcactgctactgacttgtctgaatttgctgccaaggctgcc
ttgtctgctggcaaagtctcacctgaaacagttgacagtgtgattatgggcaatgtcctg
cagagttcttcagatgctatatatttggcaaggcatgttggtttgcgtgtgggaatccca
aaggagaccccagctctcacgattaataggctctgtggttctggttttcagtccattgtg
aatggatgtcaggaaatttgtgttaaagaagctgaagttgttttatgtggaggaaccgaa
agcatgagccaagctccctactgtgtcagaaatgtgcgttttggaaccaagcttggatca
gatatcaagctggaagattctttatgggtatcattaacagatcagcatgtccagctcccc
atggcaatgactgcagagaatcttgctgtaaaacacaaaataagcagagaagaatgtgac
aaatatgccctgcagtcacagcagagatggaaagctgctaatgatgctggctactttaat
gatgaaatggcaccaattgaagtgaagacaaagaaaggaaaacagacaatgcaggtagac
gagcatgctcggccccaaaccaccctggaacagttacagaaacttcctccagtattcaag
aaagatggaactgttactgcagggaatgcatcgggtgtagctgatggtgctggagctgtt
atcatagctagtgaagatgctgttaagaaacataacttcacaccactggcaagaattgtg
ggctactttgtatctggatgtgatccctctatcatgggtattggtcctgtccctgctatc
agtggggcactgaagaaagcaggactgagtcttaaggacatggatttggtagaggtgaat
gaagcttttgctccccagtacttggctgttgagaggagtttggatcttgacataagtaaa
accaatgtgaatggaggagccattgctttgggtcacccactgggaggatctggatcaaga
attactgcacacctggttcacgaattaaggcgtcgaggtggaaaatatgccgttggatca
gcttgcattggaggtggccaaggtattgctgtcatcattcagagcacagcctga

DBGET integrated database retrieval system