KEGG   Homo sapiens (human): 10452Help
Entry
10452             CDS       T01001                                 

Gene name
TOMM40, C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Definition
(RefSeq) translocase of outer mitochondrial membrane 40
  KO
K11518  
mitochondrial import receptor subunit TOM40
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    10452 (TOMM40)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    10452 (TOMM40)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   10452 (TOMM40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 361 aa AA seqDB search
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgtgttggctgccagctcgccgcccgcagggccgccaccgccgcctgcgccg
gccctcgtggggctgccgccacctccgccctcgccgccgggcttcacgctgccgccgctg
ggaggcagcctgggcgccggcaccagtacgagtcgaagttcggaacggacccccggggct
gcaaccgccagcgcctcaggggccgccgaggatggggcctgcggctgcctgcccaacccg
ggcacattcgaggagtgccaccggaagtgcaaggagctgtttcccattcagatggagggt
gtcaagctcacagtcaacaaagggttgagtaaccattttcaggtcaaccacacagtagcc
ctcagcacaatcggggagtccaactaccacttcggggtcacatatgtggggacaaagcag
ctgagtcccacagaggcgttccctgtactggtgggtgacatggacaacagtggcagtctc
aacgctcaggtcattcaccagctgggccccggtctcaggtccaagatggccatccagacc
cagcagtcgaagtttgtgaactggcaggtggacggggagtatcggggctctgacttcaca
gcagccgtcaccctggggaacccagacgtcctcgtgggttcaggaatcctcgtagcccac
tacctccagagcatcacgccttgcctggccctgggtggagagctggtctaccaccggcgg
cctggagaggagggcactgtcatgtctctagctgggaaatacacattgaacaactggttg
gcaacggtaacgttgggccaggcgggcatgcacgcaacatactaccacaaagccagtgac
cagctgcaggtgggtgtggagtttgaggccagcacaaggatgcaggacaccagcgtctcc
ttcgggtaccagctggacctgcccaaggccaacctcctcttcaaaggctctgtggatagc
aactggatcgtgggtgccacgctggagaagaagctcccacccctgcccctgacactggcc
cttggggccttcctgaatcaccgcaagaacaagtttcagtgtggctttggcctcaccatc
ggctga

DBGET integrated database retrieval system