KEGG   Homo sapiens (human): 10452Help
Entry
10452             CDS       T01001                                 

Gene name
TOMM40, C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Definition
translocase of outer mitochondrial membrane 40 homolog (yeast)
Orthology
K11518  
mitochondrial import receptor subunit TOM40
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    10452 (TOMM40)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    10452 (TOMM40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 361 aa AA seqDB search
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgtgttggctgccagctcgccgcccgcagggccgccaccgccgcctgcgccg
gccctcgtggggctgccgccacctccgccctcgccgccgggcttcacgctgccgccgctg
ggaggcagcctgggcgccggcaccagtacgagtcgaagttcggaacggacccccggggct
gcaaccgccagcgcctcaggggccgccgaggatggggcctgcggctgcctgcccaacccg
ggcacattcgaggagtgccaccggaagtgcaaggagctgtttcccattcagatggagggt
gtcaagctcacagtcaacaaagggttgagtaaccattttcaggtcaaccacacagtagcc
ctcagcacaatcggggagtccaactaccacttcggggtcacatatgtggggacaaagcag
ctgagtcccacagaggcgttccctgtactggtgggtgacatggacaacagtggcagtctc
aacgctcaggtcattcaccagctgggccccggtctcaggtccaagatggccatccagacc
cagcagtcgaagtttgtgaactggcaggtggacggggagtatcggggctctgacttcaca
gcagccgtcaccctggggaacccagacgtcctcgtgggttcaggaatcctcgtagcccac
tacctccagagcatcacgccttgcctggccctgggtggagagctggtctaccaccggcgg
cctggagaggagggcactgtcatgtctctagctgggaaatacacattgaacaactggttg
gcaacggtaacgttgggccaggcgggcatgcacgcaacatactaccacaaagccagtgac
cagctgcaggtgggtgtggagtttgaggccagcacaaggatgcaggacaccagcgtctcc
ttcgggtaccagctggacctgcccaaggccaacctcctcttcaaaggctctgtggatagc
aactggatcgtgggtgccacgctggagaagaagctcccacccctgcccctgacactggcc
cttggggccttcctgaatcaccgcaagaacaagtttcagtgtggctttggcctcaccatc
ggctga

DBGET integrated database retrieval system