KEGG   Homo sapiens (human): 10452Help
Entry
10452             CDS       T01001                                 

Gene name
TOMM40, C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Definition
translocase of outer mitochondrial membrane 40 homolog (yeast)
Orthology
K11518  
mitochondrial import receptor subunit TOM40
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Class
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 361 aa AA seqDB search
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS
FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTI
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgtgttggctgccagctcgccgcccgcagggccgccaccgccgcctgcgccg
gccctcgtggggctgccgccacctccgccctcgccgccgggcttcacgctgccgccgctg
ggaggcagcctgggcgccggcaccagtacgagtcgaagttcggaacggacccccggggct
gcaaccgccagcgcctcaggggccgccgaggatggggcctgcggctgcctgcccaacccg
ggcacattcgaggagtgccaccggaagtgcaaggagctgtttcccattcagatggagggt
gtcaagctcacagtcaacaaagggttgagtaaccattttcaggtcaaccacacagtagcc
ctcagcacaatcggggagtccaactaccacttcggggtcacatatgtggggacaaagcag
ctgagtcccacagaggcgttccctgtactggtgggtgacatggacaacagtggcagtctc
aacgctcaggtcattcaccagctgggccccggtctcaggtccaagatggccatccagacc
cagcagtcgaagtttgtgaactggcaggtggacggggagtatcggggctctgacttcaca
gcagccgtcaccctggggaacccagacgtcctcgtgggttcaggaatcctcgtagcccac
tacctccagagcatcacgccttgcctggccctgggtggagagctggtctaccaccggcgg
cctggagaggagggcactgtcatgtctctagctgggaaatacacattgaacaactggttg
gcaacggtaacgttgggccaggcgggcatgcacgcaacatactaccacaaagccagtgac
cagctgcaggtgggtgtggagtttgaggccagcacaaggatgcaggacaccagcgtctcc
ttcgggtaccagctggacctgcccaaggccaacctcctcttcaaaggctctgtggatagc
aactggatcgtgggtgccacgctggagaagaagctcccacccctgcccctgacactggcc
cttggggccttcctgaatcaccgcaagaacaagtttcagtgtggctttggcctcaccatc
ggctga

DBGET integrated database retrieval system