KEGG   Homo sapiens (human): 10454Help
Entry
10454             CDS       T01001                                 

Gene name
TAB1, 3'-Tab1, MAP3K7IP1
Definition
TGF-beta activated kinase 1/MAP3K7 binding protein 1
Orthology
K04403  
TAK1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    10454 (TAB1)
   04064 NF-kappa B signaling pathway
    10454 (TAB1)
   04668 TNF signaling pathway
    10454 (TAB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    10454 (TAB1)
   04621 NOD-like receptor signaling pathway
    10454 (TAB1)
  Development
   04380 Osteoclast differentiation
    10454 (TAB1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    10454 (TAB1)
   05169 Epstein-Barr virus infection
    10454 (TAB1)
   05145 Toxoplasmosis
    10454 (TAB1)
   05140 Leishmaniasis
    10454 (TAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 504 aa AA seqDB search
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcttgctgcagagtgagcagcagccaagctggacagatgac
ctgcctctctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctatgatggcaaccgagtgaccaacttcgtg
gcccagcggctgtccgcagagctcctgctgggccagctgaatgccgagcacgccgaggcc
gatgtgcggcgtgtgctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgacgacgccttggctgagaaggcaagcctccagtcgcaattgccagagggagtccct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgttagagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgtctttcgcag
ctgggcttggatgctggaaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggttaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaatccatggggcacagccgctggatggg
gtgacgggcttcttggtgctgatgtcggaggggttgtacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggagattgctgcgatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtcgtggaccgggtgaagcgcatccacagcgac
accttcgccagtggtggggagcgtgccaggttctgcccccggcacgaggacatgaccctg
ctagtgaggaactttggctacccgctgggcgaaatgagccagcccacaccgagcccagcc
ccagctgcaggaggacgagtgtaccctgtgtctgtgccatactccagcgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagtgcttccaccctggacgaagccacccccaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctctgacggaggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggacggtcgtgttgagccc
tatgtggactttgctgagttttaccgcctctggagcgtggaccatggcgagcagagcgtg
gtgacagcaccgtag

DBGET integrated database retrieval system