KEGG   Homo sapiens (human): 10458Help
Entry
10458             CDS       T01001                                 

Gene name
BAIAP2, BAP2, FLAF3, IRSP53
Definition
BAI1-associated protein 2
Orthology
K05627  
BAI1-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10458 (BAIAP2)
  Cellular commiunity
   04520 Adherens junction
    10458 (BAIAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 534 aa AA seqDB search
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRSAPLLS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtctcgctcagaggagatgcaccggctcacggaaaatgtctataagaccatc
atggagcagttcaaccctagcctccggaacttcatcgccatggggaagaattacgagaag
gcactggcaggtgtgacgtatgcagccaaaggctactttgacgccctggtgaagatgggg
gagctggccagcgagagccagggctccaaagaactcggagacgttctcttccagatggct
gaagtccacaggcagatccagaatcagctggaagaaatgctgaagtcttttcacaacgag
ctgcttacgcagctggagcagaaggtggagctggactccaggtatctgagtgctgcgctg
aagaaataccagactgagcaaaggagcaaaggcgacgccctggacaagtgtcaggctgag
ctgaagaagcttcggaagaagagccagggcagcaagaatcctcagaagtactcggacaag
gagctgcagtacatcgacgccatcagcaacaagcagggcgagctggagaattacgtgtcc
gacggctacaagaccgcactgacagaggagcgcaggcgcttctgcttcctggtggagaag
cagtgcgccgtggccaagaactccgcggcctaccactccaagggcaaggagctgctggcg
cagaagctgccgctgtggcaacaggcctgtgccgaccccagcaagatcccggagcgcgcg
gtgcagctcatgcagcaggtggccagcaacggcgccaccctccccagcgccctgtcggcc
tccaagtccaacctggtcatttccgaccccattccgggggccaagcccctgccggtgccc
cccgagctggcaccgttcgtggggcggatgtctgcccaggagagcacacccatcatgaac
ggcgtcacaggcccggatggcgaggactacagcccgtgggctgaccgcaaggctgcccag
cccaaatccctgtctcctccgcagtctcagagcaagctcagcgactcctactccaacaca
ctccccgtgcgcaagagcgtgaccccaaaaaacagctatgccaccaccgagaacaagact
ctgcctcgctcgagctccatggcagccggcctggagcgcaatggccgtatgcgggtgaag
gccatcttctcccacgctgctggggacaacagcaccctcctgagcttcaaggagggtgac
ctcattaccctgctggtgcctgaggcccgcgatggctggcactacggagagagtgagaag
accaagatgcggggctggtttcccttctcctacacccgggtcttggacagcgatggcagt
gacaggctgcacatgagcctgcagcaagggaagagcagcagcacgggcaacctcctggac
aaggacgacctggccatcccaccccccgattacggcgccgcctcccgggccttccccgcc
cagacggccagcggcttcaagcagaggccctacagtgtggccgtgcccgccttctcccag
ggcctggatgactatggagcgcggtccatgagcaggaatccctttgcccacgtccagctg
aagccgacagtgaccaacgacaggtctgcccccctcctcagctga

DBGET integrated database retrieval system