KEGG   Homo sapiens (human): 10460Help
Entry
10460             CDS       T01001                                 

Gene name
TACC3, ERIC-1, ERIC1
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10460 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 838 aa AA seqDB search
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
VCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcaatgaaaaaaatacagaaaattgc
gacttcctgttttcgccaccagaagttaccggaagatcgtctgttcttcgtgtgtcacag
aaagaaaatgtgccacccaagaacctggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttcactcaggatgacacccttggactggaaaactcacacccggtctggacacagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacaccgacctcctgggggatgcaagcccagcctttgggagtggcagc
tccagcgagtctggcccaggtgccctggctgacctggactgctcaagctcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccaggaaaagtgtctggcagccctgagcaa
gccgtggaggaaaaccttagttcctattccttagacagaagagtgacacccgcctctgag
accctagaagacccttgcaggacagagtcccagcacaaagcggagactccgcacggagcc
gaggaagaatgcaaagcggagactccgcacggagccgaggaggaatgccggcacggtggg
gtctgtgctcccgcagcagtggccacttcgcctcctggtgcaatccctaaggaagcctgc
ggaggagcacccctgcagggtctgcctggcgaagccctgggctgccctgcgggtgtgggc
acccccgtgccagcagatggcactcagacccttacctgtgcacacacctctgctcctgag
agcacagccccaaccaaccacctggtggctggcagggccatgaccctgagtcctcaggaa
gaagtggctgcaggccaaatggccagctcctcgaggagcggacctgtaaaactagaattt
gatgtatctgatggcgccaccagcaaaagggcacccccaccaaggagactgggagagagg
tccggcctcaagcctcccttgaggaaagcagcagtgaggcagcaaaaggccccgcaggag
gtggaggaggacgacggtaggagcggagcaggagaggacccccccatgccagcttctcgg
ggctcttaccacctcgactgggacaaaatggatgacccaaacttcatcccgttcggaggt
gacaccaagtctggttgcagtgaggcccagcccccagaaagccctgagaccaggctgggc
cagccagcggctgaacagttgcatgctgggcctgccacggaggagccaggtccctgtctg
agccagcagctgcattcagcctcagcggaggacacgcctgtggtgcagttggcagccgag
accccaacagcagagagcaaggagagagccttgaactctgccagcacctcgcttcccaca
agctgtccaggcagtgagccagtgcccacccatcagcaggggcagcctgccttggagctg
aaagaggagagcttcagagaccccgctgaggttctaggcacgggcgcggaggtggattac
ctggagcagtttggaacttcctcgtttaaggagtcggccttgaggaagcagtccttatac
ctcaagttcgaccccctcctgagggacagtcctggtagaccagtgcccgtggccaccgag
accagcagcatgcacggtgcaaatgagactccctcaggacgtccgcgggaagccaagctt
gtggagttcgatttcttgggagcactggacattcctgtgccaggcccacccccaggtgtt
cccgcgcctgggggcccacccctgtccaccggacctatagtggacctgctccagtacagc
cagaaggacctggatgcagtggtaaaggcgacacaggaggagaaccgggagctgaggagc
aggtgtgaggagctccacgggaagaacctggaactggggaagatcatggacaggttcgaa
gaggttgtgtaccaggccatggaggaagttcagaagcagaaggaactttccaaagctgaa
atccagaaagttctaaaagaaaaagaccaacttaccacagatctgaactccatggagaag
tccttctccgacctcttcaagcgttttgagaaacagaaagaggtgatcgagggctaccgc
aagaacgaagagtcactgaagaagtgcgtggaggattacctggcaaggatcacccaggag
ggccagaggtaccaagccctgaaggcccacgcggaggagaagctgcagctggcaaacgag
gagatcgcccaggtccggagcaaggcccaggcggaagcgttggccctccaggccagcctg
aggaaggagcagatgcgcatccagtcgctggagaagacagtggagcagaagactaaagag
aacgaggagctgaccaggatctgcgacgacctcatctccaagatggagaagatctga

DBGET integrated database retrieval system