KEGG   Homo sapiens (human): 10461Help
Entry
10461             CDS       T01001                                 

Gene name
MERTK, MER, RP38, Tyro12, c-Eyk, c-mer
Definition
(RefSeq) MER proto-oncogene, tyrosine kinase (EC:2.7.10.1)
  KO
K05117  
c-mer proto-oncogene tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     10461 (MERTK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Axl family [OT]
   10461 (MERTK)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class IX (AXL receptor family)
   10461 (MERTK)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class IX (AXL receptor family)
   10461 (MERTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.1
AA seq 999 aa AA seqDB search
MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQ
PALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVP
NIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKIN
NEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNE
QPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSI
LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVS
CMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFI
PAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTE
EDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
VMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMS
SQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFL
HRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
SIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGE
RLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggggccggccccgctgccgctgctgctgggcctcttcctccccgcgctctggcgtaga
gctatcactgaggcaagggaagaagccaagccttacccgctattcccgggaccttttcca
gggagcctgcaaactgaccacacaccgctgttatcccttcctcacgccagtgggtaccag
cctgccttgatgttttcaccaacccagcctggaagaccacatacaggaaacgtagccatt
ccccaggtgacctctgtcgaatcaaagcccctaccgcctcttgccttcaaacacacagtt
ggacacataatactttctgaacataaaggtgtcaaatttaattgctcaatcagtgtacct
aatatataccaggacaccacaatttcttggtggaaagatgggaaggaattgcttggggca
catcatgcaattacacagttttatccagatgatgaagttacagcaataatcgcttccttc
agcataaccagtgtgcagcgttcagacaatgggtcgtatatctgtaagatgaaaataaac
aatgaagagatcgtgtctgatcccatctacatcgaagtacaaggacttcctcactttact
aagcagcctgagagcatgaatgtcaccagaaacacagccttcaacctcacctgtcaggct
gtgggcccgcctgagcccgtcaacattttctgggttcaaaacagtagccgtgttaacgaa
cagcctgaaaaatccccctccgtgctaactgttccaggcctgacggagatggcggtcttc
agttgtgaggcccacaatgacaaagggctgaccgtgtccaagggagtgcagatcaacatc
aaagcaattccctccccaccaactgaagtcagcatccgtaacagcactgcacacagcatt
ctgatctcctgggttcctggttttgatggatactccccgttcaggaattgcagcattcag
gtcaaggaagctgatccgctgagtaatggctcagtcatgatttttaacacctctgcctta
ccacatctgtaccaaatcaagcagctgcaagccctggctaattacagcattggtgtttcc
tgcatgaatgaaataggctggtctgcagtgagcccttggattctagccagcacgactgaa
ggagccccatcagtagcacctttaaatgtcactgtgtttctgaatgaatctagtgataat
gtggacatcagatggatgaagcctccgactaagcagcaggatggagaactggtgggctac
cggatatcccacgtgtggcagagtgcagggatttccaaagagctcttggaggaagttggc
cagaatggcagccgagctcggatctctgttcaagtccacaatgctacgtgcacagtgagg
attgcagccgtcaccagagggggagttgggcccttcagtgatccagtgaaaatatttatc
cctgcacacggttgggtagattatgccccctcttcaactccggcgcctggcaacgcagat
cctgtgctcatcatctttggctgcttttgtggatttattttgattgggttgattttatac
atctccttggccatcagaaaaagagtccaggagacaaagtttgggaatgcattcacagag
gaggattctgaattagtggtgaattatatagcaaagaaatccttctgtcggcgagccatt
gaacttaccttacatagcttgggagtcagtgaggaactacaaaataaactagaagatgtt
gtgattgacaggaatcttctaattcttggaaaaattctgggtgaaggagagtttgggtct
gtaatggaaggaaatcttaagcaggaagatgggacctctctgaaagtggcagtgaagacc
atgaagttggacaactcttcacagcgggagatcgaggagtttctcagtgaggcagcgtgc
atgaaagacttcagccacccaaatgtcattcgacttctaggtgtgtgtatagaaatgagc
tctcaaggcatcccaaagcccatggtaattttacccttcatgaaatacggggacctgcat
acttacttactttattcccgattggagacaggaccaaagcatattcctctgcagacacta
ttgaagttcatggtggatattgccctgggaatggagtatctgagcaacaggaattttctt
catcgagatttagctgctcgaaactgcatgttgcgagatgacatgactgtctgtgttgcg
gacttcggcctctctaagaagatttacagtggcgattattaccgccaaggccgcattgct
aagatgcctgttaaatggatcgccatagaaagtcttgcagaccgagtctacacaagtaaa
agtgatgtgtgggcatttggcgtgaccatgtgggaaatagctacgcggggaatgactccc
tatcctggggtccagaaccatgagatgtatgactatcttctccatggccacaggttgaag
cagcccgaagactgcctggatgaactgtatgaaataatgtactcttgctggagaaccgat
cccttagaccgccccaccttttcagtattgaggctgcagctagaaaaactcttagaaagt
ttgcctgacgttcggaaccaagcagacgttatttacgtcaatacacagttgctggagagc
tctgagggcctggcccagggctccacccttgctccactggacttgaacatcgaccctgac
tctataattgcctcctgcactccccgcgctgccatcagtgtggtcacagcagaagttcat
gacagcaaacctcatgaaggacggtacatcctgaatgggggcagtgaggaatgggaagat
ctgacttctgccccctctgctgcagtcacagctgaaaagaacagtgttttaccgggggag
agacttgttaggaatggggtctcctggtcccattcgagcatgctgcccttgggaagctca
ttgcccgatgaacttttgtttgctgacgactcctcagaaggctcagaagtcctgatgtga

DBGET integrated database retrieval system