KEGG   Homo sapiens (human): 10468Help
Entry
10468             CDS       T01001                                 

Gene name
FST, FS
Definition
follistatin
Orthology
K04661  
follistatin
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    10468 (FST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 317 aa AA seqDB search
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgcgaggcaccagccgggtgggctttgcctcctgctgctgctgctctgccag
ttcatggaggaccgcagtgcccaggctgggaactgctggctccgtcaagcgaagaacggc
cgctgccaggtcctgtacaagaccgaactgagcaaggaggagtgctgcagcaccggccgg
ctgagcacctcgtggaccgaggaggacgtgaatgacaacacactcttcaagtggatgatt
ttcaacgggggcgcccccaactgcatcccctgtaaagaaacgtgtgagaacgtggactgt
ggacctgggaaaaaatgccgaatgaacaagaagaacaaaccccgctgcgtctgcgccccg
gattgttccaacatcacctggaagggtccagtctgcgggctggatgggaaaacctaccgc
aatgaatgtgcactcctaaaggcaagatgtaaagagcagccagaactggaagtccagtac
caaggcagatgtaaaaagacttgtcgggatgttttctgtccaggcagctccacatgtgtg
gtggaccagaccaataatgcctactgtgtgacctgtaatcggatttgcccagagcctgct
tcctctgagcaatatctctgtgggaatgatggagtcacctactccagtgcctgccacctg
agaaaggctacctgcctgctgggcagatctattggattagcctatgagggaaagtgtatc
aaagcaaagtcctgtgaagatatccagtgcactggtgggaaaaaatgtttatgggatttc
aaggttgggagaggccggtgttccctctgtgatgagctgtgccctgacagtaagtcggat
gagcctgtctgtgccagtgacaatgccacttatgccagcgagtgtgccatgaaggaagct
gcctgctcctcaggtgtgctactggaagtaaagcactccggatcttgcaactga

DBGET integrated database retrieval system