KEGG   Homo sapiens (human): 10478Help
Entry
10478             CDS       T01001                                 

Gene name
SLC25A17, PMP34
Definition
(RefSeq) solute carrier family 25 member 17
  KO
K13354  
solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    10478 (SLC25A17)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   10478 (SLC25A17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.2
AA seq 307 aa AA seqDB search
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEG
LLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTT
PLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPA
IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPE
NRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG
LKRAHQH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgtgctgtcctacgaaagcctggtccacgccgtggccggagccgtgggaagc
gtgacagcaatgacagtgttttttcccctggatacagctagacttcgacttcaggttgat
gagaaaagaaaatccaaaactacacacatggtgctcctggagatcattaaagaagaagga
ctcctggcaccatatcgagggtggtttccagtgatttccagtctctgctgctccaatttt
gtctatttctacacttttaatagcctcaaagcactctgggtcaaaggtcaacattctacc
actggaaaagatctggtagttgggtttgttgcaggagtggttaatgtgttgctaacaact
ccactctgggtggtaaacaccagactgaagcttcaaggagcaaaatttaggaatgaagac
attgtaccaacaaactacaaaggtatcattgatgcttttcatcagatcattcgcgatgaa
ggaatctcggctttatggaatggcacatttccctcattgctgttggtcttcaatcctgcc
atccagttcatgttttatgaaggtttaaaacggcagcttttaaagaaacggatgaagctt
tcttccttggatgtgttcatcattggtgcagtagccaaagcgattgccaccacggtgacc
tatcccctgcagacggtacagtcaattctgaggtttgggcgtcatagactaaacccagaa
aacagaacattgggaagtcttcggaatattctctatcttcttcaccaacgagtaagacgt
tttggaataatgggactctacaaaggccttgaagccaaactgctgcagacagtcctcact
gctgctctcatgttccttgtttatgagaaactgacagctgccaccttcacagttatgggg
ctgaagcgtgcacaccaacactga

DBGET integrated database retrieval system