KEGG   Homo sapiens (human): 10478Help
Entry
10478             CDS       T01001                                 

Gene name
SLC25A17, PMP34
Definition
solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Orthology
K13354  
solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    10478 (SLC25A17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.2
AA seq 270 aa AA seqDB search
MIDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQ
HSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQII
RDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIAT
TVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQT
VLTAALMFLVYEKLTAATFTVMGLKRAHQH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgagaaaagaaaatccaaaactacacacatggtgctcctggagatcattaaa
gaagaaggactcctggcaccatatcgagggtggtttccagtgatttccagtctctgctgc
tccaattttgtctatttctacacttttaatagcctcaaagcactctgggtcaaaggtcaa
cattctaccactggaaaagatctggtagttgggtttgttgcaggagtggttaatgtgttg
ctaacaactccactctgggtggtaaacaccagactgaagcttcaaggagcaaaatttagg
aatgaagacattgtaccaacaaactacaaaggtatcattgatgcttttcatcagatcatt
cgcgatgaaggaatctcggctttatggaatggcacatttccctcattgctgttggtcttc
aatcctgccatccagttcatgttttatgaaggtttaaaacggcagcttttaaagaaacgg
atgaagctttcttccttggatgtgttcatcattggtgcagtagccaaagcgattgccacc
acggtgacctatcccctgcagacggtacagtcaattctgaggtttgggcgtcatagacta
aacccagaaaacagaacattgggaagtcttcggaatattctctatcttcttcaccaacga
gtaagacgttttggaataatgggactctacaaaggccttgaagccaaactgctgcagaca
gtcctcactgctgctctcatgttccttgtttatgagaaactgacagctgccaccttcaca
gttatggggctgaagcgtgcacaccaacactga

DBGET integrated database retrieval system