KEGG   Homo sapiens (human): 10479Help
Entry
10479             CDS       T01001                                 

Gene name
SLC9A6, MRSA, NHE6
Definition
solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6
Orthology
K12041  
solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Disease
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    10479 (SLC9A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.3
AA seq 701 aa AA seqDB search
MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASDGGGGEARAMDEEIVSE
KQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGI
HVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYMLKGEISSHELNNVQDNEMLRKVTFDP
EVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVT
GQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSS
SIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLL
ETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFL
AENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNF
QHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRV
GVDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPI
ARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDA
LDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcgcggctggcggcgggcacccctccgccgtggcgtcggcagcagtccccga
gcccgcaggctcatgcggcccctttggttgctcctcgcagtgggcgtctttgactgggca
ggggcttcggacggcggcggcggagaggctagagccatggacgaggagatcgtgtccgag
aagcaagccgaggagagccaccggcaggacagcgccaacctgctcatcttcatcctgctg
ctcaccctcaccattctcacaatctggctcttcaagcaccgccgggcccgcttcctgcac
gaaaccggcctggctatgatttatggtcttttggtgggccttgtgcttcggtatggcatt
catgttccgagtgatgtaaataatgtgaccctgagctgtgaagtgcagtcaagtccaact
accttactggtaaatgttagtggaaaattttatgagtatatgctgaaaggagagattagt
tcacatgaactcaataatgttcaagataatgaaatgcttagaaaggttacttttgatcca
gaagtatttttcaacatattacttcctcctatcatattttatgcaggttatagcctgaaa
aggagacatttttttcgaaatcttgggtctatcctagcatacgcttttcttggaacagca
atttcttgtttcgttattgggtcaataatgtatggctgtgtaacgctgatgaaggtaacg
ggacaacttgcaggagatttttactttacagattgcctactgtttggtgccattgtatca
gcaactgatccagtgactgttcttgctatattccacgagcttcaagttgatgttgaactc
tatgcacttctttttggtgaaagtgtcctcaatgatgctgttgccatagtgctgtcctcc
tcaatagtggcataccagccagctggagacaacagtcacacctttgatgtcacagcgatg
ttcaagtctattgggatcttccttggaatcttcagtggatcttttgcaatgggtgctgct
actggagtggtgacagctttagtgacaaagttcaccaaattacgggagttccagttgttg
gagacaggcctgttcttcttgatgtcctggagtaccttcctcttggctgaagcatggggc
ttcacaggtgtagttgcagtattgttttgtggcatcacacaagcacattatacgtataat
aatttgtccacggagtctcagcatagaactaaacagttgtttgagcttctcaatttcttg
gcagagaatttcatcttctcctacatggggctgacactgttcaccttccagaaccatgtc
tttaacccaacatttgtagtaggagcatttgttgctattttcttgggaagagctgccaat
atttaccccttgtccctcttacttaatttgggtagaagaagtaagattggatcaaatttt
caacacatgatgatgtttgctggccttcgtggtgcaatggcatttgccttggccattcga
gatactgccacttatgcacggcaaatgatgttcagcaccacgcttctgattgtgtttttt
accgtgtgggtatttggtggtggcaccactgcaatgctgtcatgcttgcatatcagggtt
ggtgttgattcagaccaagaacacttgggtgttcctgaaaatgaaaggagaactaccaaa
gcagagagtgcttggcttttccggatgtggtacaactttgatcataactatctgaagcct
ctgctgacccacagcgggcctccgctgacaacaacactccctgcctgctgtggacccatc
gccaggtgcctcaccagcccccaggcttacgaaaaccaggaacagttgaaagatgatgat
tctgatcttattctcaatgatggtgacatcagtttgacatatggagattctactgtgaac
actgaaccggccacatccagcgccccaaggagatttatgggaaacagttctgaagatgcc
ttggatcgggagcttgcatttggggaccatgaactggtcattcgaggaacacgcctggtt
cttccaatggatgattctgaacccccgctaaatttgttagataatacgagacatggtcca
gcctaa

DBGET integrated database retrieval system