KEGG   Homo sapiens (human): 1048Help
Entry
1048              CDS       T01001                                 

Gene name
CEACAM5, CD66e, CEA
Definition
carcinoembryonic antigen-related cell adhesion molecule 5
Orthology
K06499  
carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Technetium (99mTc) arcitumomab: 
Other: 
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1048 (CEACAM5)
  Exosomal proteins of bladder cancer cells
   1048 (CEACAM5)
Cellular antigens [BR:hsa04090]
 Proteins
  1048 (CEACAM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1-q13.2
AA seq 702 aa AA seqDB search
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTI
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggagtctccctcggcccctccccacagatggtgcatcccctggcagaggctcctgctc
acagcctcacttctaaccttctggaacccgcccaccactgccaagctcactattgaatcc
acgccgttcaatgtcgcagaggggaaggaggtgcttctacttgtccacaatctgccccag
catctttttggctacagctggtacaaaggtgaaagagtggatggcaaccgtcaaattata
ggatatgtaataggaactcaacaagctaccccagggcccgcatacagtggtcgagagata
atataccccaatgcatccctgctgatccagaacatcatccagaatgacacaggattctac
accctacacgtcataaagtcagatcttgtgaatgaagaagcaactggccagttccgggta
tacccggagctgcccaagccctccatctccagcaacaactccaaacccgtggaggacaag
gatgctgtggccttcacctgtgaacctgagactcaggacgcaacctacctgtggtgggta
aacaatcagagcctcccggtcagtcccaggctgcagctgtccaatggcaacaggaccctc
actctattcaatgtcacaagaaatgacacagcaagctacaaatgtgaaacccagaaccca
gtgagtgccaggcgcagtgattcagtcatcctgaatgtcctctatggcccggatgccccc
accatttcccctctaaacacatcttacagatcaggggaaaatctgaacctctcctgccac
gcagcctctaacccacctgcacagtactcttggtttgtcaatgggactttccagcaatcc
acccaagagctctttatccccaacatcactgtgaataatagtggatcctatacgtgccaa
gcccataactcagacactggcctcaataggaccacagtcacgacgatcacagtctatgca
gagccacccaaacccttcatcaccagcaacaactccaaccccgtggaggatgaggatgct
gtagccttaacctgtgaacctgagattcagaacacaacctacctgtggtgggtaaataat
cagagcctcccggtcagtcccaggctgcagctgtccaatgacaacaggaccctcactcta
ctcagtgtcacaaggaatgatgtaggaccctatgagtgtggaatccagaacgaattaagt
gttgaccacagcgacccagtcatcctgaatgtcctctatggcccagacgaccccaccatt
tccccctcatacacctattaccgtccaggggtgaacctcagcctctcctgccatgcagcc
tctaacccacctgcacagtattcttggctgattgatgggaacatccagcaacacacacaa
gagctctttatctccaacatcactgagaagaacagcggactctatacctgccaggccaat
aactcagccagtggccacagcaggactacagtcaagacaatcacagtctctgcggagctg
cccaagccctccatctccagcaacaactccaaacccgtggaggacaaggatgctgtggcc
ttcacctgtgaacctgaggctcagaacacaacctacctgtggtgggtaaatggtcagagc
ctcccagtcagtcccaggctgcagctgtccaatggcaacaggaccctcactctattcaat
gtcacaagaaatgacgcaagagcctatgtatgtggaatccagaactcagtgagtgcaaac
cgcagtgacccagtcaccctggatgtcctctatgggccggacacccccatcatttccccc
ccagactcgtcttacctttcgggagcgaacctcaacctctcctgccactcggcctctaac
ccatccccgcagtattcttggcgtatcaatgggataccgcagcaacacacacaagttctc
tttatcgccaaaatcacgccaaataataacgggacctatgcctgttttgtctctaacttg
gctactggccgcaataattccatagtcaagagcatcacagtctctgcatctggaacttct
cctggtctctcagctggggccactgtcggcatcatgattggagtgctggttggggttgct
ctgatatag

DBGET integrated database retrieval system