KEGG   Homo sapiens (human): 10482Help
Entry
10482             CDS       T01001                                 

Gene name
NXF1, MEX67, TAP
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  
nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10482 (NXF1)
   03015 mRNA surveillance pathway
    10482 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    10482 (NXF1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    10482 (NXF1)
   05168 Herpes simplex infection
    10482 (NXF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     10482 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     10482 (NXF1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10482 (NXF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UBU9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.3
AA seq 619 aa AA seqDB search
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggggaagtcgtacagcgaacacgatgatgaacgcgttaatttccctcaa
agaaagaagaaaggccggggtcccttccggtggaaatatggtgaaggaaaccgtaggtct
ggaagaggcggttctggtattcggtcttcccgccttgaggaagatgatggagatgtggca
atgagtgatgcccaggatggtccccgagtacgatacaacccctataccacccgacctaac
cgtcggggtgatacttggcatgatcgagatcgcattcatgttactgtgcggagagacaga
gctcctccagagagaggaggggctggcaccagccaggatgggacctcaaagaactggttc
aagattacaattccttatggcagaaagtatgacaaggcatggctcctgagcatgattcag
agcaagtgcagtgtgcccttcacccctattgagtttcactatgagaatacacgggcccag
ttcttcgttgaagacgccagtactgcctctgcattgaaggctgtcaactataagattttg
gatcgggagaaccgaaggatatctatcatcatcaactcttctgctccaccccacactata
ctgaatgaactgaagccagaacaagtagaacagctaaagctgatcatgagcaaacgatac
gatggctcccaacaagcccttgacctcaaaggcctccgttcagacccagatttggtggcc
cagaacattgacgttgtcctgaatcgcagaagctgtatggcagctaccctgaggatcatt
gaagagaacatccctgagctattgtccttgaacttgagcaacaacaggctgtacaggctg
gatgacatgtctagcattgttcagaaggcacccaacctgaagatcctaaacctttctgga
aatgaattgaagtctgagcgggaattggacaagataaaggggctgaagctagaagagctc
tggctcgatggaaactccctgtgtgacaccttccgagaccagtccacctacatcagcgcc
attcgcgaacgatttcccaagttactacgcctggatggccatgagctacccccaccaatt
gcctttgatgttgaagcccccacgacgttaccgccctgcaagggaagctattttggaaca
gaaaacttgaagagtctggtcttgcacttcctgcaacagtactatgcaatttacgactct
ggagaccgacaagggctcctggatgcctaccatgatggggcctgctgttccctgagcatt
cctttcattcctcagaaccctgcccgaagcagcttagccgagtatttcaaggatagcaga
aatgtgaagaagcttaaagaccctaccttgcggttccggctgctgaagcacacgcgtctc
aacgttgttgccttcctcaatgagttgcccaaaacccagcacgacgtcaattccttcgtg
gtagacataagcgcccagacaagcacattgctgtgtttttctgtcaatggagtcttcaag
gaagtggacggaaagtcccgggattctttgcgagccttcacccggacattcattgctgtt
cctgctagcaattcagggctatgtattgtaaatgatgagctatttgtgcggaatgccagt
tctgaagagatccaaagagccttcgctatgcctgcacccacgccttcctccagcccggtg
cccaccctctctccagagcagcaggaaatgttgcaagcattctctacccagtctggcatg
aacctcgagtggtcccagaagtgccttcaggacaacaactgggactacaccagatctgcc
caggccttcactcatctcaaggccaagggcgagatcccagaagtggcattcatgaagtga

DBGET integrated database retrieval system