KEGG   Homo sapiens (human): 10497Help
Entry
10497             CDS       T01001                                 

Gene name
UNC13B, MUNC13, UNC13, Unc13h2
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    10497 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13.3
AA seq 1591 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcgctgaagactattcgtcagtcggatgaggaagggcctggggaatggtccacattagag
gcagagacgttaatgaaagacgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccagaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgccgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcttccca
cctccttaccatacagcttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
cgatcgccacagcagctgctacttcaaggcagttcccgggactcttgtaatgactctatg
caaagttatgaccttgattatccagagcggcgggctatcagccccaccagcagcagtagg
tatggctcctcctgtaatgtgagtcaaggaagctctcagctaagtgaactagaccagtat
cacgaacaagatgacgaccatcgggagacggactcgattcattcttgccacagctctcac
agcctgtccagagatggccaagcaggttttggagaacaagagaaacccttggaggtgaca
ggtcaagcagagaaggaggcagcatgtgaacccaaggagatgaaagaagatgccacaacc
caccctcccccagatctggtgctgcaaaaagaccacttcctaggtccccaggagagtttt
cctgaggagaatgcatcttcaccatttacccaagccagagcacattggatccgagcagtt
accaaggttcgactccagctgcaggagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctgtcactggtccagtctcggaaggcagga
atcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcccacgtg
tataagaaaaccctgcaggccttaatctaccccatttcgtgcaccactcctcataacttt
gaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctctggggc
attgcccggcagggcatgcgctgcagcgaatgtggagtcaagtgccatgagaagtgccag
gatctgctcaatgctgactgcctgcagcgggctgcagaaaagagctgtaaacatggagct
gaggaccggacccagaacattatcatggccatgaaggaccgcatgaagatccgagagcga
aataagccagagatctttgaagttatccgggacgtcttcacagtgaacaaagctgcccat
gtgcagcagatgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcagcc
aagatcaccattactgtggtgtgtgcccagggcctacaagccaaggacaaaacaggatcc
agtgacccttacgtgactgtgcaagtcagcaaaactaagaagcgtaccaagaccattttt
ggaaacttgaatcctgtttgggaggagaagttccattttgagtgccacaactcctctgac
cgcattaaggtgcgtgtatgggatgaggatgatgacatcaagtcaagagtaaagcaacgc
ctaaagcgagagtctgatgatttccttggccaaaccatcattgaggttcggaccctaagt
ggcgagatggacgtctggtacaacttggagaagaggacagacaaatcagccgtctcaggg
gctatccgactacaaatcagtgtggagatcaagggggaggagaaagtagccccataccac
gtgcagtatacatgtctccatgagaatcttttccattacctcacagacattcagggcagt
ggaggagtccgcatccctgaagctcgaggagacgatgcctggaaggtgtactttgatgag
acagcccaagaaattgtggatgaatttgccatgcgttatggcattgagtccatatatcag
gccatgacgcactttgcatgtttatcatccaagtacatgtgtcctggtgtgccagcagtg
atgagcaccttactggccaacatcaacgcctactatgcccacacaactgcctctaccaat
gtctctgcatctgatcgctttgcagcctccaactttgggaaagagagatttgtaaaactg
ctggaccagctacacaactcactgaggatcgacctctctacatacaggaataatttccct
gctgggagtcctgaacggcttcaggacttaaaatccacagtggatttgctgaccagcatt
actttcttcagaatgaaggtacaagaactgcaaagccctccaagagccagccaggtggta
aaggattgtgtgaaggcctgtttgaactccacatatgaatatatcttcaacaactgccac
gacttatacagccgccagtaccagctgaagcaggagctacctccagaggaacaagggccc
agcattcggaacctggatttctggcccaagctcatcacactcatcgtgtcaatcatagag
gaagataagaattcctacacacctgttctgaaccagtttcctcaggagttgaatgtggga
aaagtcagcgcagaagtgatgtggcatttgtttgcccaagacatgaaatatgcattggag
gagcatgagaaagaccacctgtgtaaaagtgctgactacatgaacctgcacttcaaggtg
aagtggctccacaatgaatacgtgcgggatctgcctgtcctccaggggcaggtgcctgag
tacccagcgtggtttgagcagttcgtgctacaatggctggatgagaatgaggatgtatcc
ctggaattcctgcgtggggccctggaacgagataagaaggatggattccagcagacatca
gagcatgcactcttttcctgctctgtggtggatgtcttcacacaactcaatcagagcttt
gagatcatccggaagctggaatgcccagaccccagcatccttgcccactacatgaggagg
tttgctaagaccatcgggaaggtgctgatgcagtatgcagacatcttgtcaaaggacttc
ccagcctattgcacaaaggagaaactgccctgcatcctgatgaacaacgtgcagcaactg
agggtccagctggagaaaatgtttgaggccatgggaggcaaggagctggaccttgaagct
gcagacagtctgaaggagctgcaggtgaaactgaatacggttctggatgagctcagcatg
gtgtttggaaacagtttccaggtacggattgatgagtgtgttcgacaaatggccgacatc
ctgggccaggttcggggcacagggaatgcatctccagacgccagggcctcagcggctcag
gatgcagatagcgtactccggcctctcatggacttcctggatggcaacctcaccctcttt
gccactgtgtgtgagaagacggttctgaagcgtgtactgaaggagctctggcgcgtggtg
atgaacacaatggagaggatgattgttctgcccccactcactgaccagacgggcacccag
ctgatcttcactgctgccaaggagctgagccatctttccaaactcaaggatcacatggta
cgagaggaaacacggaatctcactccaaagcagtgtgcagtccttgacctcgccctggac
accatcaagcaatacttccatgcaggaggcaatgggctgaagaaaaccttcctggagaag
agcccagatctgcagtctctacgctatgccctgtctctgtacacacagactactgacact
ctcatcaagacctttgtgcgctcgcagaccacccaagggtctggtgtggacgatcctgtg
ggagaagtctctattcaggtggacttgtttacacaccctggtactggggagcacaaggtc
acagtgaaagtggtggctgccaatgacctcaagtggcagacagcgggtatgttccggcct
ttcgtggaggtgactatggttggcccacaccaaagtgataagaagaggaagttcacaacc
aaatccaaaagcaacaactgggcccccaagtacaatgagacattccacttcctcctggga
aatgaggaggggcccgagtcctatgagttgcagatatgcgtgaaggattactgctttgcc
cgggaagatcgcgtgctagggctggctgtgatgcctctgagggatgtcacagccaagggc
agctgtgcctgctggtgccccttgggccggaagatccatatggatgagacaggcctgacc
attctccggattttatctcagaggagcaatgacgaggtggcccgagaatttgtgaaactc
aaatcagagtctcgttccacggaggaggggagctga

DBGET integrated database retrieval system