KEGG   Homo sapiens (human): 105Help
Entry
105               CDS       T01001                                 

Gene name
ADARB2, ADAR3, RED2
Definition
adenosine deaminase, RNA-specific, B2 (non-functional)
Orthology
K13194  
double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
10p15.3
AA seq 739 aa AA seqDB search
MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAPFKHLSPGITNTEDDD
TLSTSSAEVKENRNVGNLAARPPPSGDRARGGAPGAKRKRPLEEGNGGHLCKLQLVWKKL
SWSVAPKNALVQLHELRPGLQYRTVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMR
AAELALRSFVQFPNACQAHLAMGGGPGPGTDFTSDQADFPDTLFQEFEPPAPRPGLAGGR
PGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPVVLLNRLRAGLRYVCLAEPAE
RRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQELFDIQMPGHAPGRARRTPMPQE
FADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQAQVVALSSGTKCISGEH
LSDQGLVVNDCHAEVVARRAFLHFLYTQLELHLSKRREDSERSIFVRLKEGGYRLRENIL
FHLYVSTSPCGDARLHSPYEITTDLHSSKHLVRKFRGHLRTKIESGEGTVPVRGPSAVQT
WDGVLLGEQLITMSCTDKIARWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMS
HRMEGVGQLPASYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSC
GGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKA
GLGTWVRKPPEQQQFLLTL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggtcctggggagcggcagagggtctggagggctgagcagtcaactcaaatgc
aagtccaagaggaggaggaggcggaggtccaagcggaaagataaagtaagcatattgtca
accttcctcgctcctttcaagcacctgagtcctggcatcacaaacacggaggatgacgac
accctcagtaccagcagcgcggaggtgaaggagaaccgcaacgtgggcaacctggccgcg
cggccaccgccctccggggaccgggcccggggcggcgcgcccggcgcgaagaggaagcgg
ccgctggaggaggggaatgggggccacttgtgcaaactgcagctggtctggaagaagctg
tcgtggtcggtggcgcccaagaacgcgctggtgcagctgcacgagctgaggccgggcctg
cagtaccggacagtgtcgcagacgggcccggtgcatgccccggtcttcgcggtagcggtg
gaggtgaacgggctcacgttcgagggcacaggccccaccaagaagaaggccaagatgcgc
gcggcggagctggcactcaggtccttcgtgcagttccccaacgcctgccaggcgcacctg
gccatgggcgggggcccgggccccggcacggacttcacctccgaccaggccgatttcccc
gacacgctcttccaggagttcgagcccccggcgccgcgccccggactcgcgggaggccgc
cccggggacgccgcgcttctgtccgcggcctacgggcgacggcggctgctgtgccgcgcg
ctggacctggtgggcccgacccccgccacccccgcggccccgggcgagcgcaaccccgtg
gtgctgctgaaccgcctgcgcgccgggctgcgctacgtgtgtctggcagaaccggccgag
cggcgcgcgcggagcttcgtgatggccgtgagcgtggacggcaggacgttcgagggctcg
gggcgcagcaagaagctggcccggggtcaggccgcgcaggccgcactgcaggagctgttc
gacatccagatgcccggccacgcgcccggcagggccaggaggacgccaatgccgcaggaa
ttcgcagactccatatcccagctggtcacacagaagttccgcgaggtgacgacggacctc
acgcccatgcacgcccgccataaagcgctggcaggaatcgtcatgaccaaaggcctggat
gctcggcaggcgcaggtcgtggccctgtcctcggggaccaagtgcatcagcggcgagcac
ctcagtgaccaggggctggtggtgaatgactgccacgcggaggtcgtggcccggcgggcg
ttcctgcacttcctctacacgcagctggagctgcacctgagcaagcggcgcgaggactca
gagcgatcgatattcgtgcggttaaaagaaggtggctaccggctgcgagagaacatcctc
ttccatctctacgtgagcacctccccctgtggagacgcaagactccactctccctacgag
atcaccacagacctgcacagcagcaaacacctcgtcaggaagttccgcgggcacctgcgc
accaagatcgagtccggggaagggacggtccccgtgcgtggccccagcgcagtgcagacc
tgggacggcgtcctgctgggggagcagctgatcaccatgtcctgcacggacaagatcgcc
aggtggaacgtcctggggctgcagggcgcgctcctgtcccacttcgtggagcccgtgtac
ctgcagagcatcgtggtgggcagcctgcaccacacgggccacctcgcacgcgtcatgagc
caccgcatggagggtgtcggccagctgcccgcctcctaccggcacaaccggcctctcctc
agcggcgtgagtgacgccgaggcgcgccagccggggaagtcgccccccttcagcatgaac
tgggtcgtgggcagcgcggacctggagattatcaacgccaccactgggcggaggagctgt
gggggcccatcccggctctgcaagcacgtgctgtctgcacggtgggcgcggctgtatggc
aggctgagcacacggacacccagccctggagacacgccctccatgtactgtgaggccaag
ctgggggcgcacacctaccagtctgtgaaacagcagctgttcaaggcctttcagaaggct
ggcctgggcacctgggtgaggaaaccaccggagcagcagcagtttctactgactctctag

DBGET integrated database retrieval system