KEGG   Homo sapiens (human): 105Help
Entry
105               CDS       T01001                                 

Gene name
ADARB2, ADAR3, RED2
Definition
adenosine deaminase, RNA-specific, B2 (non-functional)
Orthology
K13194  
double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     105 (ADARB2)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    105 (ADARB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
10p15.3
AA seq 739 aa AA seqDB search
MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAPFKHLSPGITNTEDDD
TLSTSSAEVKENRNVGNLAARPPPSGDRARGGAPGAKRKRPLEEGNGGHLCKLQLVWKKL
SWSVAPKNALVQLHELRPGLQYRTVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMR
AAELALRSFVQFPNACQAHLAMGGGPGPGTDFTSDQADFPDTLFQEFEPPAPRPGLAGGR
PGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPVVLLNRLRAGLRYVCLAEPAE
RRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQELFDIQMPGHAPGRARRTPMPQE
FADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQAQVVALSSGTKCISGEH
LSDQGLVVNDCHAEVVARRAFLHFLYTQLELHLSKRREDSERSIFVRLKEGGYRLRENIL
FHLYVSTSPCGDARLHSPYEITTDLHSSKHLVRKFRGHLRTKIESGEGTVPVRGPSAVQT
WDGVLLGEQLITMSCTDKIARWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMS
HRMEGVGQLPASYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSC
GGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKA
GLGTWVRKPPEQQQFLLTL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggtcctggggagcggcagagggtctggagggctgagcagtcaactcaaatgc
aagtccaagaggaggaggaggcggaggtccaagcggaaagataaagtaagcatattgtca
accttcctcgctcctttcaagcacctgagtcctggcatcacaaacacggaggatgacgac
accctcagtaccagcagcgcggaggtgaaggagaaccgcaacgtgggcaacctggccgcg
cggccaccgccctccggggaccgggcccggggcggcgcgcccggcgcgaagaggaagcgg
ccgctggaggaggggaatgggggccacttgtgcaaactgcagctggtctggaagaagctg
tcgtggtcggtggcgcccaagaacgcgctggtgcagctgcacgagctgaggccgggcctg
cagtaccggacagtgtcgcagacgggcccggtgcatgccccggtcttcgcggtagcggtg
gaggtgaacgggctcacgttcgagggcacaggccccaccaagaagaaggccaagatgcgc
gcggcggagctggcactcaggtccttcgtgcagttccccaacgcctgccaggcgcacctg
gccatgggcgggggcccgggccccggcacggacttcacctccgaccaggccgatttcccc
gacacgctcttccaggagttcgagcccccggcgccgcgccccggactcgcgggaggccgc
cccggggacgccgcgcttctgtccgcggcctacgggcgacggcggctgctgtgccgcgcg
ctggacctggtgggcccgacccccgccacccccgcggccccgggcgagcgcaaccccgtg
gtgctgctgaaccgcctgcgcgccgggctgcgctacgtgtgtctggcagaaccggccgag
cggcgcgcgcggagcttcgtgatggccgtgagcgtggacggcaggacgttcgagggctcg
gggcgcagcaagaagctggcccggggtcaggccgcgcaggccgcactgcaggagctgttc
gacatccagatgcccggccacgcgcccggcagggccaggaggacgccaatgccgcaggaa
ttcgcagactccatatcccagctggtcacacagaagttccgcgaggtgacgacggacctc
acgcccatgcacgcccgccataaagcgctggcaggaatcgtcatgaccaaaggcctggat
gctcggcaggcgcaggtcgtggccctgtcctcggggaccaagtgcatcagcggcgagcac
ctcagtgaccaggggctggtggtgaatgactgccacgcggaggtcgtggcccggcgggcg
ttcctgcacttcctctacacgcagctggagctgcacctgagcaagcggcgcgaggactca
gagcgatcgatattcgtgcggttaaaagaaggtggctaccggctgcgagagaacatcctc
ttccatctctacgtgagcacctccccctgtggagacgcaagactccactctccctacgag
atcaccacagacctgcacagcagcaaacacctcgtcaggaagttccgcgggcacctgcgc
accaagatcgagtccggggaagggacggtccccgtgcgtggccccagcgcagtgcagacc
tgggacggcgtcctgctgggggagcagctgatcaccatgtcctgcacggacaagatcgcc
aggtggaacgtcctggggctgcagggcgcgctcctgtcccacttcgtggagcccgtgtac
ctgcagagcatcgtggtgggcagcctgcaccacacgggccacctcgcacgcgtcatgagc
caccgcatggagggtgtcggccagctgcccgcctcctaccggcacaaccggcctctcctc
agcggcgtgagtgacgccgaggcgcgccagccggggaagtcgccccccttcagcatgaac
tgggtcgtgggcagcgcggacctggagattatcaacgccaccactgggcggaggagctgt
gggggcccatcccggctctgcaagcacgtgctgtctgcacggtgggcgcggctgtatggc
aggctgagcacacggacacccagccctggagacacgccctccatgtactgtgaggccaag
ctgggggcgcacacctaccagtctgtgaaacagcagctgttcaaggcctttcagaaggct
ggcctgggcacctgggtgaggaaaccaccggagcagcagcagtttctactgactctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system