KEGG   Homo sapiens (human): 10505Help
Entry
10505             CDS       T01001                                 

Gene name
SEMA4F, M-SEMA, PRO2353, S4F, SEMAM, SEMAW, m-Sema-M
Definition
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Orthology
K06521  
semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10505 (SEMA4F)
Cellular antigens [BR:hsa04090]
 Proteins
  10505 (SEMA4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
2p13.1
AA seq 615 aa AA seqDB search
MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVP
HTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKEG
DLGGRKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWE
GATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFG
SSLSLPDRVLTFIRDHPLMDRPVFPADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYL
GTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGR
LQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEV
PVATAAHVVLPCSPSSAWASCVWHQPSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGA
AHVVAAYSLVWGSQRDAPSRAHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLAR
DKVGLDLGAPPSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHI
RLTGAPLATCDETSI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctctgctgcgcggccccgcccgggtcccgggcagcctacagcctcgcccttc
ccgctactgctgctggcggtgctgagcggcccggtatccggccgcgtcccccgctcggtg
cccagaacctcgcttccaatctctgaggctgactcctgtctcacccggttcgcagtccct
cacacatacaattactctgttctccttgtggatcctgcctcccacacactttatgttggc
gcccgggacaccatcttcgctttatccctgcccttctcaggggagagaccccgcaggatt
gactggatggttcctgaggctcacagacagaactgtaggaagaaaggcaagaaagagggg
gacctcgggggccggaagaccctccagcagagatggacgacgtttttgaaagctgacctg
ctctgtccagggcctgagcatggccgggcctccagtgtcctgcaggatgttgctgtgctt
cgacctgagcttggggcagggactcccatcttttatggcatcttttcttcccagtgggag
ggggctactatctctgctgtctgtgccttccgaccacaagacattcggacagtgctgaat
ggtcccttcagagaactaaaacatgactgcaacagaggactgcctgtcgtggacaatgat
gtgccccagcccagacctggagagtgcatcaccaacaacatgaagctccggcactttggc
tcatctctctccctgcctgaccgcgtactcaccttcatccgggaccacccactcatggac
aggccagtgtttccagctgatggccaccccctgctggtcactacagatacagcctatctc
agagtcgtggcccacagggtgaccagcctctcagggaaagagtatgatgtgctctacctg
gggacagaggatggacacctccaccgagcagtgcggatcggagctcagctcagcgttctt
gaagatctggccttattcccagagccacagccagttgagaacatgaaattgtaccacagc
tggctcctggttggctcccgtactgaggtgacacaagtgaatacaaccaactgtggccgt
ctccagagctgctcagagtgcatcctggcccaggacccagtctgtgcctggagcttccgg
ctggatgagtgtgtggcccatgccggggagcaccgagggttggtccaagacatagagtca
gcagatgtctcctctttgtgtcctaaagagcctggagaacgtccagtagtgtttgaagtt
cccgtggctacagctgcgcatgtggtcttgccatgttctccaagctcagcatgggcatcc
tgtgtgtggcaccagcccagtggagtgactgcactcaccccccggcgggatggactggag
gtggtggtgaccccaggggccatgggcgcttatgcctgtgaatgtcaggagggtggggca
gcccatgtggtagcagcttacagcttggtatggggcagccagcgagatgctccgagccgg
gcccacacagtgggggcgggactggctggcttcttcttggggattctcgcagcatccctg
actctcattctgattggtcggcgtcagcagcgacggcgacagagggaacttctggctaga
gacaaggtgggcctggacctgggggctccaccttctgggaccacaagctacagccaagac
cctccctccccctctcctgaagatgagcggttgccgctggccctggccaagaggggcagt
ggctttggtggattctcaccacccttcctgcttgatccttgcccaagcccagcccacatt
cggctaactggggctcctctagccacatgtgatgaaacatccatctag

DBGET integrated database retrieval system