KEGG   Homo sapiens (human): 10505Help
Entry
10505             CDS       T01001                                 

Gene name
SEMA4F, M-SEMA, PRO2353, S4F, SEMAM, SEMAW, m-Sema-M
Definition
(RefSeq) ssemaphorin 4F
  KO
K06521  
semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10505 (SEMA4F)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP2; neuropilin 2 [KO:K06819]
   10505 (SEMA4F)
  PLXNA; plexin A [KO:K06820]
   10505 (SEMA4F)
  PLXNB; plexin B [KO:K06821]
   10505 (SEMA4F)
Cellular antigens [BR:hsa04090]
 Proteins
  10505 (SEMA4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
2p13.1
AA seq 770 aa AA seqDB search
MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVP
HTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKED
ECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAA
VMAGGVLYAATVKNYLGTEPIITRAVGRAEDWIRTDTLPSWLNAPAFVAAVALSPAEWGD
EDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKADLLCPGP
EHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRE
LKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLAL
FPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECV
AHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQ
PSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSRAHTVG
AGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPS
PEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctctgctgcgcggccccgcccgggtcccgggcagcctacagcctcgcccttc
ccgctactgctgctggcggtgctgagcggcccggtatccggccgcgtcccccgctcggtg
cccagaacctcgcttccaatctctgaggctgactcctgtctcacccggttcgcagtccct
cacacatacaattactctgttctccttgtggatcctgcctcccacacactttatgttggc
gcccgggacaccatcttcgctttatccctgcccttctcaggggagagaccccgcaggatt
gactggatggttcctgaggctcacagacagaactgtaggaagaaaggcaagaaagaggac
gaatgtcacaattttgtccagattctcgccattgccaatgcctctcacctcctcacttgt
ggcaccttcgcttttgatccgaagtgcggggttattgatgtgtccaggttccagcaggtt
gaaagacttgagagtggccgggggaaatgtccttttgagccagctcagcggtcagcagct
gtaatggctgggggggtcctctatgctgccactgtgaaaaactacctggggacggagcca
attatcaccagagcagtgggtcgtgccgaggactggattcggacagataccttgccttcc
tggctgaacgccccagcctttgtcgcagccgtggccttgagcccagccgaatggggggat
gaagatggagacgacgaaatctacttcttctttacggagacttcccgagcatttgactca
tacgagcgcattaaagtcccacgggtggcccgtgtgtgtgcgggggacctcgggggccgg
aagaccctccagcagagatggacgacgtttttgaaagctgacctgctctgtccagggcct
gagcatggccgggcctccagtgtcctgcaggatgttgctgtgcttcgacctgagcttggg
gcagggactcccatcttttatggcatcttttcttcccagtgggagggggctactatctct
gctgtctgtgccttccgaccacaagacattcggacagtgctgaatggtcccttcagagaa
ctaaaacatgactgcaacagaggactgcctgtcgtggacaatgatgtgccccagcccaga
cctggagagtgcatcaccaacaacatgaagctccggcactttggctcatctctctccctg
cctgaccgcgtactcaccttcatccgggaccacccactcatggacaggccagtgtttcca
gctgatggccaccccctgctggtcactacagatacagcctatctcagagtcgtggcccac
agggtgaccagcctctcagggaaagagtatgatgtgctctacctggggacagaggatgga
cacctccaccgagcagtgcggatcggagctcagctcagcgttcttgaagatctggcctta
ttcccagagccacagccagttgagaacatgaaattgtaccacagctggctcctggttggc
tcccgtactgaggtgacacaagtgaatacaaccaactgtggccgtctccagagctgctca
gagtgcatcctggcccaggacccagtctgtgcctggagcttccggctggatgagtgtgtg
gcccatgccggggagcaccgagggttggtccaagacatagagtcagcagatgtctcctct
ttgtgtcctaaagagcctggagaacgtccagtagtgtttgaagttcccgtggctacagct
gcgcatgtggtcttgccatgttctccaagctcagcatgggcatcctgtgtgtggcaccag
cccagtggagtgactgcactcaccccccggcgggatggactggaggtggtggtgacccca
ggggccatgggcgcttatgcctgtgaatgtcaggagggtggggcagcccatgtggtagca
gcttacagcttggtatggggcagccagcgagatgctccgagccgggcccacacagtgggg
gcgggactggctggcttcttcttggggattctcgcagcatccctgactctcattctgatt
ggtcggcgtcagcagcgacggcgacagagggaacttctggctagagacaaggtgggcctg
gacctgggggctccaccttctgggaccacaagctacagccaagaccctccctccccctct
cctgaagatgagcggttgccgctggccctggccaagaggggcagtggctttggtggattc
tcaccacccttcctgcttgatccttgcccaagcccagcccacattcggctaactggggct
cctctagccacatgtgatgaaacatccatctag

DBGET integrated database retrieval system