KEGG   Homo sapiens (human): 1051Help
Entry
1051              CDS       T01001                                 

Gene name
CEBPB, C/EBP-beta, CRP2, IL6DBP, NF-IL6, TCF5
Definition
CCAAT/enhancer binding protein (C/EBP), beta
Orthology
K10048  
CCAAT/enhancer binding protein (C/EBP), beta
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
Tuberculosis
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1051 (CEBPB)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1051 (CEBPB)
  Infectious diseases
   05152 Tuberculosis
    1051 (CEBPB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1051 (CEBPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.1
AA seq 322 aa AA seqDB search
MEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLG
APQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLG
RLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGF
PYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKA
KKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRE
LSTLRNLFKQLPEPLLASSGHC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggccaacttctactacgaggcggactgcttggctgctgcgtacggcggcaag
gcggcccccgcggcgccccccgcggccagacccgggccgcgcccccccgccggcgagctg
ggcagcatcggcgaccacgagcgcgccatcgacttcagcccgtacctggagccgctgggc
gcgccgcaggccccggcgcccgccacggccacggacaccttcgaggcggctccgcccgcg
cccgcccccgcgcccgcctcctccgggcagcaccacgacttcctctccgacctcttctcc
gacgactacgggggcaagaactgcaagaagccggccgagtacggctacgtgagcctgggg
cgcctgggggccgccaagggcgcgctgcaccccggctgcttcgcgcccctgcacccaccg
cccccgccgccgccgccgcccgccgagctcaaggcggagccgggcttcgagcccgcggac
tgcaagcggaaggaggaggccggggcgccgggcggcggcgcaggcatggcggcgggcttc
ccgtacgcgctgcgcgcttacctcggctaccaggcggtgccgagcggcagcagcgggagc
ctctccacgtcctcctcgtccagcccgcccggcacgccgagccccgctgacgccaaggcg
cccccgaccgcctgctacgcgggggccgcgccggcgccctcgcaggtcaagagcaaggcc
aagaagaccgtggacaagcacagcgacgagtacaagatccggcgcgagcgcaacaacatc
gccgtgcgcaagagccgcgacaaggccaagatgcgcaacctggagacgcagcacaaggtc
ctggagctcacggccgagaacgagcggctgcagaagaaggtggagcagctgtcgcgcgag
ctcagcaccctgcggaacttgttcaagcagctgcccgagcccctgctcgcctcctccggc
cactgctag

DBGET integrated database retrieval system