KEGG   Homo sapiens (human): 10512Help
Entry
10512             CDS       T01001                                 

Gene name
SEMA3C, SEMAE, SemE
Definition
(RefSeq) semaphorin 3C
  KO
K06840  
semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10512 (SEMA3C)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     10512 (SEMA3C)
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   10512 (SEMA3C)
  NRP2; neuropilin 2 [KO:K06819]
   10512 (SEMA3C)
  PLXNA; plexin A [KO:K06820]
   10512 (SEMA3C)
  PLXND; plexin D [KO:K06822]
   10512 (SEMA3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q31
AA seq 751 aa AA seqDB search
MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVF
KNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGD
ESQKMRGDYGKLKALINSRKSRNRRNQLPES
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcattccggacaatttgcgtgttggttggagtatttatttgttctatctgtgtgaaa
ggatcttcccagccccaagcaagagtttatttaacatttgatgaacttcgagaaaccaag
acctctgaatacttcagcctttcccaccatcctttagactacaggattttattaatggat
gaagatcaggaccggatatatgtgggaagcaaagatcacattctttccctgaatattaac
aatataagtcaagaagctttgagtgttttctggccagcatctacaatcaaagttgaagaa
tgcaaaatggctggcaaagatcccacacacggctgtgggaactttgtccgtgtaattcag
actttcaatcgcacacatttgtatgtctgtgggagtggcgctttcagtcctgtctgtact
tacttgaacagagggaggagatcagaggaccaagttttcatgattgactccaagtgtgaa
tctggaaaaggacgctgctctttcaaccccaacgtgaacacggtgtctgttatgatcaat
gaggagcttttctctggaatgtatatagatttcatggggacagatgctgctatttttcga
agtttaaccaagaggaatgcggtcagaactgatcaacataattccaaatggctaagtgaa
cctatgtttgtagatgcacatgtcatcccagatggtactgatccaaatgatgctaaggtg
tacttcttcttcaaagaaaaactgactgacaataacaggagcacgaaacagattcattcc
atgattgctcgaatatgtcctaatgacactggtggactgcgtagccttgtcaacaagtgg
accactttcttaaaggcgaggctggtgtgctcggtaacagatgaagacggcccagaaaca
cactttgatgaattagaggatgtgtttctgctggaaactgataacccgaggacaacacta
gtgtatggcatttttacaacatcaagctcagttttcaaaggatcagccgtgtgtgtgtat
catttatctgatatacagactgtgtttaatgggccttttgcccacaaagaagggcccaat
catcagctgatttcctatcagggcagaattccatatcctcgccctggaacttgtccagga
ggagcatttacacccaatatgcgaaccaccaaggagttcccagatgatgttgtcactttt
attcggaaccatcctctcatgtacaattccatctacccaatccacaaaaggcctttgatt
gttcgtattggcactgactacaagtatacaaagatagctgtggatcgagtgaacgctgct
gatgggagataccatgtcctgtttctcggaacagatcggggtactgtgcaaaaagtggtt
gttcttcctactaacaactctgtcagtggcgagctcattctggaggagctggaagtcttt
aagaatcatgctcctataacaacaatgaaaatttcatctaaaaagcaacagttgtatgtg
agttccaatgaaggggtttcccaggtatctctgcaccgctgccacatctatggtacagcc
tgtgctgactgctgcctggcgcgggacccttattgcgcctgggatggccattcctgttcc
agattctacccaactgggaaacggaggagccgaagacaagatgtgagacatggaaaccca
ctgactcaatgcagaggatttaatctaaaagcatacagaaatgcagctgaaattgtccag
tatggagtaaaaaataacaccacttttctggagtgtgcccccaagtctccgcaggcatct
atcaagtggctgttacagaaagacaaagacaggaggaaagaggttaagctgaatgaacga
ataatagccacttcacagggactcctgatccgctctgttcagggttctgaccaaggactt
tatcactgcattgctacagaaaatagtttcaagcagaccatagccaagatcaacttcaaa
gttttagattcagaaatggtggctgttgtgacggacaaatggtccccatggacctgggcc
agctctgtgagggctttacccttccacccgaaggacatcatgggggcattcagccactca
gaaatgcagatgattaaccaatattgcaaagacactcggcagcaacatcagcagggagat
gaatcacagaaaatgagaggggactatggcaagttaaaggccctcatcaatagtcggaaa
agtagaaacaggaggaatcagttgccagagtcataa

DBGET integrated database retrieval system