KEGG   Homo sapiens (human): 10512Help
Entry
10512             CDS       T01001                                 

Gene name
SEMA3C, SEMAE, SemE
Definition
(RefSeq) semaphorin 3C
  KO
K06840  semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10512 (SEMA3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema I-set Ig_3 PSI V-set Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 10512
NCBI-ProteinID: NP_006370
OMIM: 602645
HGNC: 10725
Ensembl: ENSG00000075223
Vega: OTTHUMG00000023447
Pharos: Q99985(Tbio)
UniProt: Q99985
Position
7q21.11
AA seq 751 aa AA seqDB search
MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVF
KNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGD
ESQKMRGDYGKLKALINSRKSRNRRNQLPES
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcattccggacaatttgcgtgttggttggagtatttatttgttctatctgtgtgaaa
ggatcttcccagccccaagcaagagtttatttaacatttgatgaacttcgagaaaccaag
acctctgaatacttcagcctttcccaccatcctttagactacaggattttattaatggat
gaagatcaggaccggatatatgtgggaagcaaagatcacattctttccctgaatattaac
aatataagtcaagaagctttgagtgttttctggccagcatctacaatcaaagttgaagaa
tgcaaaatggctggcaaagatcccacacacggctgtgggaactttgtccgtgtaattcag
actttcaatcgcacacatttgtatgtctgtgggagtggcgctttcagtcctgtctgtact
tacttgaacagagggaggagatcagaggaccaagttttcatgattgactccaagtgtgaa
tctggaaaaggacgctgctctttcaaccccaacgtgaacacggtgtctgttatgatcaat
gaggagcttttctctggaatgtatatagatttcatggggacagatgctgctatttttcga
agtttaaccaagaggaatgcggtcagaactgatcaacataattccaaatggctaagtgaa
cctatgtttgtagatgcacatgtcatcccagatggtactgatccaaatgatgctaaggtg
tacttcttcttcaaagaaaaactgactgacaataacaggagcacgaaacagattcattcc
atgattgctcgaatatgtcctaatgacactggtggactgcgtagccttgtcaacaagtgg
accactttcttaaaggcgaggctggtgtgctcggtaacagatgaagacggcccagaaaca
cactttgatgaattagaggatgtgtttctgctggaaactgataacccgaggacaacacta
gtgtatggcatttttacaacatcaagctcagttttcaaaggatcagccgtgtgtgtgtat
catttatctgatatacagactgtgtttaatgggccttttgcccacaaagaagggcccaat
catcagctgatttcctatcagggcagaattccatatcctcgccctggaacttgtccagga
ggagcatttacacccaatatgcgaaccaccaaggagttcccagatgatgttgtcactttt
attcggaaccatcctctcatgtacaattccatctacccaatccacaaaaggcctttgatt
gttcgtattggcactgactacaagtatacaaagatagctgtggatcgagtgaacgctgct
gatgggagataccatgtcctgtttctcggaacagatcggggtactgtgcaaaaagtggtt
gttcttcctactaacaactctgtcagtggcgagctcattctggaggagctggaagtcttt
aagaatcatgctcctataacaacaatgaaaatttcatctaaaaagcaacagttgtatgtg
agttccaatgaaggggtttcccaggtatctctgcaccgctgccacatctatggtacagcc
tgtgctgactgctgcctggcgcgggacccttattgcgcctgggatggccattcctgttcc
agattctacccaactgggaaacggaggagccgaagacaagatgtgagacatggaaaccca
ctgactcaatgcagaggatttaatctaaaagcatacagaaatgcagctgaaattgtccag
tatggagtaaaaaataacaccacttttctggagtgtgcccccaagtctccgcaggcatct
atcaagtggctgttacagaaagacaaagacaggaggaaagaggttaagctgaatgaacga
ataatagccacttcacagggactcctgatccgctctgttcagggttctgaccaaggactt
tatcactgcattgctacagaaaatagtttcaagcagaccatagccaagatcaacttcaaa
gttttagattcagaaatggtggctgttgtgacggacaaatggtccccatggacctgggcc
agctctgtgagggctttacccttccacccgaaggacatcatgggggcattcagccactca
gaaatgcagatgattaaccaatattgcaaagacactcggcagcaacatcagcagggagat
gaatcacagaaaatgagaggggactatggcaagttaaaggccctcatcaatagtcggaaa
agtagaaacaggaggaatcagttgccagagtcataa

DBGET integrated database retrieval system