KEGG   Homo sapiens (human): 10525Help
Entry
10525             CDS       T01001                                 

Gene name
HYOU1, GRP-170, Grp170, HSP12A, ORP-150, ORP150
Definition
hypoxia up-regulated 1
Orthology
K09486  
hypoxia up-regulated 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.1-q23.3
AA seq 999 aa AA seqDB search
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaagttaggaggcagaggccgaggaggcgagtctgttgggccttggtggct
gtgctcttggcagacctgttggcactgagtgatacactggcagtgatgtctgtggacctg
ggcagtgagtccatgaaggtggccattgtcaaacctggagtgcccatggaaattgtcttg
aataaggaatctcggaggaaaacaccggtgatcgtgaccctgaaagaaaatgaaagattc
tttggagacagtgcagcaagcatggcgattaagaatccaaaggctacgctacgttacttc
cagcacctcctggggaagcaggcagataacccccatgtagctctttaccaggcccgcttc
ccggagcacgagctgactttcgacccacagaggcagactgtgcactttcagatcagctcg
cagctgcagttctcacctgaggaagtgttgggcatggttctcaattattctcgttctcta
gctgaagattttgcagagcagcccatcaaggatgcagtgatcaccgtgccagtcttcttc
aaccaggccgagcgccgagctgtgctgcaggctgctcgtatggctggcctcaaagtgctg
cagctcatcaatgacaacaccgccactgccctcagctatggtgtcttccgccggaaagat
attaacaccactgcccagaatatcatgttctatgacatgggctcaggcagcaccgtatgc
accattgtgacctaccagatggtgaagactaaggaagctgggatgcagccacagctgcag
atccggggagtaggatttgaccgtaccctggggggcctggagatggagctccggcttcga
gaacgcctggctgggcttttcaatgagcagcgcaagggtcagagagcaaaggatgtgcgg
gagaacccgcgtgccatggccaagctgctgcgtgaggctaatcggctcaaaaccgtcctc
agtgccaacgctgaccacatggcacagattgaaggcctgatggatgatgtggacttcaag
gcaaaagtgactcgtgtggaatttgaggagttgtgtgcagacttgtttgagcgggtgcct
gggcctgtacagcaggccctccagagtgccgaaatgagtctggatgagattgagcaggtg
atcctggtgggtggggccactcgggtccccagagttcaggaggtgctgctgaaggccgtg
ggcaaggaggagctggggaagaacatcaatgcagatgaagcagccgccatgggggcagtg
taccaggcagctgcgctcagcaaagcctttaaagtgaagccatttgtcgtccgagatgca
gtggtctaccccatcctggtggagttcacgagggaggtggaggaggagcctgggattcac
agcctgaagcacaataaacgggtactcttctctcggatggggccctaccctcaacgcaaa
gtcatcacctttaaccgctacagccatgatttcaacttccacatcaactacggcgacctg
ggcttcctggggcctgaagatcttcgggtatttggctcccagaatctgaccacagtgaag
ctaaaaggggtgggtgacagcttcaagaagtatcctgactacgagtccaagggcatcaag
gctcacttcaacctggatgagagtggcgtgctcagtctagacagggtggagtctgtattt
gagacactggtagaggacagcgcagaagaggaatctactctcaccaaacttggcaacacc
atttccagcctgtttggaggcggtaccacaccagatgccaaggagaatggtactgatact
gtccaggaggaagaggagagccctgcagaggggagcaaggacgagcctggggagcaggtg
gagctcaaggaggaagctgaggccccagtggaggatggctctcagcccccaccccctgaa
cctaagggagatgcaacccctgagggagaaaaggccacagaaaaagaaaatggggacaag
tctgaggcccagaaaccaagtgagaaggcagaggcagggcctgagggcgtcgctccagcc
ccagagggagagaagaagcagaagcccgccaggaagcggcgaatggtagaggagatcggg
gtggagctggttgttctggacctgcctgacttgccagaggataagctggctcagtcggtg
cagaaacttcaggacttgacactccgagacctggagaagcaggaacgggaaaaagctgcc
aacagcttggaagcattcatatttgagacccaggacaagctgtaccagcccgagtaccag
gaagtgtccacagaggagcagcgtgaggagatctctgggaagctcagcgccgcatccacc
tggctggaggatgagggtgttggagccaccacagtgatgttgaaggagaagctggctgag
ctgaggaagctgtgccaagggctgttttttcgggtagaggagcgcaagaagtggcccgaa
cggctgtctgccctcgataatctcctcaaccattccagcatgttcctcaagggggcccgg
ctcatcccagagatggaccagatcttcactgaggtggagatgacaacgttagagaaagtc
atcaatgagacctgggcctggaagaatgcaactctggccgagcaggctaagctgcccgcc
acagagaagcctgtgttgctctcaaaagacattgaagctaagatgatggccctggaccga
gaggtgcagtatctgctcaataaggccaagtttaccaagccccggccccggcctaaggac
aagaatgggacccgggcagagccacccctcaatgccagtgccagtgaccagggggagaag
gtcatccctccagcaggccagactgaagatgcagagcccatttcagaacctgagaaagta
gagactggatccgagccaggagacactgagcctttggagttaggaggtcctggagcagaa
cctgaacagaaagaacaatcgacaggacagaagcggcctttgaagaacgacgaactataa

DBGET integrated database retrieval system