KEGG   Homo sapiens (human): 10528Help
Entry
10528             CDS       T01001                                 

Gene name
NOP56, NOL5A, SCA36
Definition
NOP56 ribonucleoprotein
Orthology
K14564  
nucleolar protein 56
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00063  
Spinocerebellar ataxia (SCA)
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 594 aa AA seqDB search
MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVA
LENANAVSEGVVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAE
ILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDK
DINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAK
AKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALI
GEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRA
AAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDV
MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPK
KKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPK
EETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgttgcacgtgctgtttgagcacgcggtcggctacgcgctgctggcgctgaag
gaagtggaggagatcagtctgctgcagccgcaggtggaggagtctgtgctcaacctgggc
aaattccacagcatcgttcgtctggtggccttttgtccctttgcctcatcccaggttgcc
ttggaaaatgccaacgccgtgtctgaaggggttgttcatgaggacctccgcctgctcttg
gagacccacctgccgtccaaaaagaagaaagtactcttgggagttggggatcccaagatt
ggtgccgcaatacaggaggagttagggtacaactgccagactggaggagtcatagctgag
atcctgcgaggagttcgtctgcacttccacaatctggtgaagggtctgaccgatctgtca
gcttgtaaagcacagctggggctgggacacagctattcccgtgccaaagttaagtttaat
gtgaaccgggtggacaatatgatcatccagtccattagcctcctggaccagctggataag
gacatcaataccttctctatgcgtgtcagggagtggtacgggtatcactttccggagctg
gtgaagatcatcaacgacaatgccacatactgccgtcttgcccagtttattggaaaccga
agggaactgaatgaggacaagctggagaagctggaggagctgacaatggatggggccaag
gctaaggctattctggatgcctcacggtcctccatgggcatggacatatctgccattgac
ttgataaacatcgagagcttctccagtcgtgtggtgtctttatctgaataccgccagagc
ctacacacttacctgcgctccaagatgagccaagtagcccccagcctgtcagccctaatt
ggggaagcggtaggtgcacgtctcatcgcacatgctggcagcctcaccaacctggccaag
tatccagcatccacagtgcagatccttggggctgaaaaggccctgttcagagccctgaag
acaaggggtaacactccaaaatatggactcattttccactccaccttcattggccgagca
gctgccaagaacaaaggccgcatctcccgatacctggcaaacaaatgcagtattgcctca
cgaatcgattgcttctctgaggtgcccacgagtgtattcggggagaagcttcgagaacaa
gttgaagagcgactgtccttctatgagactggagagataccacgaaagaatctggatgtc
atgaaggaagcaatggttcaggcagaggaagcggctgctgagattactaggaagctggag
aaacaggagaagaaacgcttaaagaaggaaaagaaacggctggctgcacttgccctcgcg
tcttcagaaaacagcagtagtactccagaggagtgtgaggagatgagtgaaaaacccaaa
aagaagaaaaagcaaaagccccaggaggttcctcaggagaatggaatggaagacccatct
atctctttctccaaacccaagaaaaagaaatctttttccaaggaggagttgatgagtagc
gatcttgaagagaccgctggcagcaccagtattcccaagaggaagaagtctacacccaag
gaggaaacagttaatgaccctgaggaggcaggccacagaagtggctccaagaaaaagagg
aaattctccaaagaggagccggtcagcagtgggcctgaagaggcggttggcaagagcagc
tccaagaagaagaaaaagttccataaagcatcccaggaagattag

DBGET integrated database retrieval system