KEGG   Homo sapiens (human): 10533Help
Entry
10533             CDS       T01001                                 

Gene name
ATG7, APG7-LIKE, APG7L, GSA7
Definition
autophagy related 7
Orthology
K08337  
ubiquitin-like modifier-activating enzyme ATG7
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25.3
AA seq 676 aa AA seqDB search
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQ
ETQAAEIWDMSDDETI
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctacgggggatcctggactctctaaactgcagtttgccccttttagtagt
gccttggatgttgggttttggcatgagttgacccagaagaagctgaacgagtatcggctg
gatgaagctcccaaggacattaagggttattactacaatggtgactctgctgggctgcca
gctcgcttaacattggagttcagtgcttttgacatgagtgctcccaccccagcccgttgc
tgcccagctattggaacactgtataacaccaacacactcgagtctttcaagactgcagat
aagaagctccttttggaacaagcagcaaatgagatatgggaatccataaaatcaggcact
gctcttgaaaaccctgtactcctcaacaagttcctcctcttgacatttgcagatctaaag
aagtaccacttctactattggttttgctatcctgccctctgtcttccagagagtttacct
ctcattcaggggccagtgggtttggatcaaaggttttcactaaaacagattgaagcacta
gagtgtgcatatgataatctttgtcaaacagaaggagtcacagctcttccttacttctta
atcaagtatgatgagaacatggtgctggtttccttgcttaaacactacagtgatttcttc
caaggtcaaaggacgaagataacaattggtgtatatgatccctgtaacttagcccagtac
cctggatggcctttgaggaattttttggtcctagcagcccacagatggagtagcagtttc
cagtctgttgaagttgtttgcttccgtgaccgtaccatgcagggggcgagagacgttgcc
cacagcatcatcttcgaagtgaagcttccagaaatggcatttagcccagattgtcctaaa
gcagttggatgggaaaagaaccagaaaggaggcatgggaccaaggatggtgaacctcagt
gaatgtatggaccctaaaaggttagctgagtcatcagtggatctaaatctcaaactgatg
tgttggagattggttcctactttagacttggacaaggttgtgtctgtcaaatgtctgctg
cttggagccggcaccttgggttgcaatgtagctaggacgttgatgggttggggcgtgaga
cacatcacatttgtggacaatgccaagatctcctactccaatcctgtgaggcagcctctc
tatgagtttgaagattgcctagggggtggtaagcccaaggctctggcagcagcggaccgg
ctccagaaaatattccccggtgtgaatgccagaggattcaacatgagcatacctatgcct
gggcatccagtgaacttctccagtgtcactctggagcaagcccgcagagatgtggagcaa
ctggagcagctcatcgaaagccatgatgtcgtcttcctattgatggacaccagggagagc
cggtggcttcctgccgtcattgctgcaagcaagagaaagctggtcatcaatgctgctttg
ggatttgacacatttgttgtcatgagacatggtctgaagaaaccaaagcagcaaggagct
ggggacttgtgtccaaaccaccctgtggcatctgctgacctcctgggctcatcgcttttt
gccaacatccctggttacaagcttggctgctacttctgcaatgatgtggtggccccagga
gattcaaccagagaccggaccttggaccagcagtgcactgtgagtcgtccaggactggcc
gtgattgcaggagccctggccgtggaattgatggtatctgttttgcagcatccagaaggg
ggctatgccattgccagcagcagtgacgatcggatgaatgagcctccaacctctcttggg
cttgtgcctcaccaggttcttgatcaatatgaacgagaaggatttaacttcctagccaag
gtgtttaattcttcacattccttcttagaagacttgactggtcttacattgctgcatcaa
gaaacccaagctgctgagatctgggacatgagcgatgatgagaccatctga

DBGET integrated database retrieval system