KEGG   Homo sapiens (human): 10533Help
Entry
10533             CDS       T01001                                 

Gene name
ATG7, APG7-LIKE, APG7L, GSA7
Definition
(RefSeq) autophagy related 7
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04216  Ferroptosis
Network
N00156  Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    10533 (ATG7)
   04136 Autophagy - other eukaryotes
    10533 (ATG7)
  Cell growth and death
   04216 Ferroptosis
    10533 (ATG7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    10533 (ATG7)
   Atg8 conjugation proteins
    10533 (ATG7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10533 (ATG7)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    10533 (ATG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG7_N ThiF Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 10533
NCBI-ProteinID: NP_006386
OMIM: 608760
HGNC: 16935
Ensembl: ENSG00000197548
Vega: OTTHUMG00000129740
Pharos: O95352(Tbio)
UniProt: O95352 B3KQM6
Position
3p25.3
AA seq 703 aa AA seqDB search
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctacgggggatcctggactctctaaactgcagtttgccccttttagtagt
gccttggatgttgggttttggcatgagttgacccagaagaagctgaacgagtatcggctg
gatgaagctcccaaggacattaagggttattactacaatggtgactctgctgggctgcca
gctcgcttaacattggagttcagtgcttttgacatgagtgctcccaccccagcccgttgc
tgcccagctattggaacactgtataacaccaacacactcgagtctttcaagactgcagat
aagaagctccttttggaacaagcagcaaatgagatatgggaatccataaaatcaggcact
gctcttgaaaaccctgtactcctcaacaagttcctcctcttgacatttgcagatctaaag
aagtaccacttctactattggttttgctatcctgccctctgtcttccagagagtttacct
ctcattcaggggccagtgggtttggatcaaaggttttcactaaaacagattgaagcacta
gagtgtgcatatgataatctttgtcaaacagaaggagtcacagctcttccttacttctta
atcaagtatgatgagaacatggtgctggtttccttgcttaaacactacagtgatttcttc
caaggtcaaaggacgaagataacaattggtgtatatgatccctgtaacttagcccagtac
cctggatggcctttgaggaattttttggtcctagcagcccacagatggagtagcagtttc
cagtctgttgaagttgtttgcttccgtgaccgtaccatgcagggggcgagagacgttgcc
cacagcatcatcttcgaagtgaagcttccagaaatggcatttagcccagattgtcctaaa
gcagttggatgggaaaagaaccagaaaggaggcatgggaccaaggatggtgaacctcagt
gaatgtatggaccctaaaaggttagctgagtcatcagtggatctaaatctcaaactgatg
tgttggagattggttcctactttagacttggacaaggttgtgtctgtcaaatgtctgctg
cttggagccggcaccttgggttgcaatgtagctaggacgttgatgggttggggcgtgaga
cacatcacatttgtggacaatgccaagatctcctactccaatcctgtgaggcagcctctc
tatgagtttgaagattgcctagggggtggtaagcccaaggctctggcagcagcggaccgg
ctccagaaaatattccccggtgtgaatgccagaggattcaacatgagcatacctatgcct
gggcatccagtgaacttctccagtgtcactctggagcaagcccgcagagatgtggagcaa
ctggagcagctcatcgaaagccatgatgtcgtcttcctattgatggacaccagggagagc
cggtggcttcctgccgtcattgctgcaagcaagagaaagctggtcatcaatgctgctttg
ggatttgacacatttgttgtcatgagacatggtctgaagaaaccaaagcagcaaggagct
ggggacttgtgtccaaaccaccctgtggcatctgctgacctcctgggctcatcgcttttt
gccaacatccctggttacaagcttggctgctacttctgcaatgatgtggtggccccagga
gattcaaccagagaccggaccttggaccagcagtgcactgtgagtcgtccaggactggcc
gtgattgcaggagccctggccgtggaattgatggtatctgttttgcagcatccagaaggg
ggctatgccattgccagcagcagtgacgatcggatgaatgagcctccaacctctcttggg
cttgtgcctcaccagatccggggatttctttcacggtttgataatgtccttcccgtcagc
ctggcatttgacaaatgtacagcttgttcttccaaagttcttgatcaatatgaacgagaa
ggatttaacttcctagccaaggtgtttaattcttcacattccttcttagaagacttgact
ggtcttacattgctgcatcaagaaacccaagctgctgagatctgggacatgagcgatgat
gagaccatctga

DBGET integrated database retrieval system