KEGG   Homo sapiens (human): 1054Help
Entry
1054              CDS       T01001                                 

Gene name
CEBPG, GPE1BP, IG/EBP-1
Definition
CCAAT/enhancer binding protein (C/EBP), gamma
Orthology
K10049  
CCAAT/enhancer binding protein (C/EBP), gamma
Organism
hsa  Homo sapiens (human)
Pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1054 (CEBPG)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1054 (CEBPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.11
AA seq 150 aa AA seqDB search
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD
LFLEHAHNLADNVQSISTENTTADGDNAGQ
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatatcgcagcaaaacagcactccaggggtgaacggaattagtgttatccat
acccaggcacatgccagcggcttacagcaggttcctcagctggtgcctgctggccctggg
ggaggaggcaaagctgtggctcccagcaagcagagcaaaaagagttcgcccatggatcga
aacagtgacgagtatcggcaacgccgagagaggaacaacatggctgtgaaaaagagccgg
ttgaaaagcaagcagaaagcacaagacacactgcagagagtcaatcagctcaaagaagag
aatgaacggttggaagcaaaaatcaaattgctgaccaaggaattaagtgtactcaaagat
ttgtttcttgagcatgcacacaaccttgcagacaacgtacagtccattagcactgaaaat
acgacagcagatggcgacaatgcaggacagtag

DBGET integrated database retrieval system