KEGG   Homo sapiens (human): 10552Help
Entry
10552             CDS       T01001                                 

Gene name
ARPC1A, Arc40, HEL-68, HEL-S-307, SOP2Hs, SOP2L
Definition
(RefSeq) actin related protein 2/3 complex subunit 1A
  KO
K05757  
actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10552 (ARPC1A)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10552 (ARPC1A)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10552 (ARPC1A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10552 (ARPC1A)
   05132 Salmonella infection
    10552 (ARPC1A)
   05131 Shigellosis
    10552 (ARPC1A)
   05100 Bacterial invasion of epithelial cells
    10552 (ARPC1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10552 (ARPC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 370 aa AA seqDB search
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcatcagtttttactagagccaatcacctgtcatgcctggaacagggatcgt
actcagattgccctcagtcccaataatcacgaagtgcacatctataagaagaacgggagc
cagtgggtgaaagctcatgaactcaaggagcacaacggacacatcacaggtattgactgg
gctcccaagagcgaccgcattgtcacttgtggggcagaccgcaatgcctatgtctggagt
cagaaagatggtgtttggaagccaaccctggtgatcctgagaattaatcgcgcagctact
tttgtgaagtggtcccccctagagaacaaatttgctgtgggaagtggagcacgactcatt
tctgtttgttactttgagtctgaaaatgactggtgggtgagcaagcacattaaaaagccg
attcgctccacagtcctcagcttggattggcatcccaacaacgttttgctggcagcagga
tcatgtgacttcaaatgcagagtgttttctgcctacattaaagaagtggatgaaaagcca
gccagcacgccctggggcagcaagatgccttttgggcagctgatgtcagagtttggtggc
agtggcactggtggctgggtccacggggtaagcttctctgccagtgggagccgcctggcc
tgggtcagccacgacagcaccgtgtctgttgctgatgcctcaaaaagtgtgcaggtctcg
actctgaagacagagttcctgccgctcctaagtgtgtcatttgtctcagagaacagcgtc
gtggctgctggccatgactgctgcccaatgctctttaactacgatgaccgcggctgcctg
accttcgtctccaagttagatattccaaaacagagcatccaacgcaacatgtctgccatg
gaacgcttccgcaacatggacaagagagccacaactgaggaccgcaacacggccttggag
acgctgcaccagaatagcatcactcaagtctctatttatgaggtggacaagcaagattgt
cgcaaattttgcactactggcatcgatggagccatgacaatttgggatttcaagaccctc
gagtcttccatccagggcctccggataatgtga

DBGET integrated database retrieval system