KEGG   Homo sapiens (human): 10554Help
Entry
10554             CDS       T01001                                 

Gene name
AGPAT1, 1-AGPAT1, G15, LPAAT-alpha, LPAATA
Definition
1-acylglycerol-3-phosphate O-acyltransferase 1 (EC:2.3.1.51)
Orthology
K13509  
lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    10554 (AGPAT1)
   00564 Glycerophospholipid metabolism
    10554 (AGPAT1)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    10554 (AGPAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     10554 (AGPAT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   10554 (AGPAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 283 aa AA seqDB search
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtggccaggggcatggatgctgctgctgctgctcttcctgctgctgctcttc
ctgctgcccaccctgtggttctgcagccccagtgccaagtacttcttcaagatggccttc
tacaatggctggatcctcttcctggctgtgctcgccatccctgtgtgtgccgtgcgagga
cgcaacgtcgagaacatgaagatcttgcgtctaatgctgctccacatcaaatacctgtac
gggatccgagtggaggtgcgaggggctcaccacttccctccctcgcagccctatgttgtt
gtctccaaccaccagagctctctcgatctgcttgggatgatggaggtactgccaggccgc
tgtgtgcccattgccaagcgcgagctactgtgggctggctctgccgggctggcctgctgg
ctggcaggagtcatcttcatcgaccggaagcgcacgggggatgccatcagtgtcatgtct
gaggtcgcccagaccctgctcacccaggacgtgagggtctgggtgtttcctgagggaacg
agaaaccacaatggctccatgctgcccttcaaacgtggcgccttccatcttgcagtgcag
gcccaggttcccattgtccccatagtcatgtcctcctaccaagacttctactgcaagaag
gagcgtcgcttcacctcgggacaatgtcaggtgcgggtgctgcccccagtgcccacggaa
gggctgacaccagatgacgtcccagctctggctgacagagtccggcactccatgctcact
gttttccgggaaatctccactgatggccggggtggtggtgactatctgaagaagcctggg
ggcggtgggtga

DBGET integrated database retrieval system