KEGG   Homo sapiens (human): 10557Help
Entry
10557             CDS       T01001                                 

Gene name
RPP38
Definition
ribonuclease P/MRP 38kDa subunit (EC:3.1.26.5)
Orthology
K14523  
ribonucleases P/MRP protein subunit RPP38 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p13
AA seq 283 aa AA seqDB search
MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKI
EDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV
TRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLAL
AFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctcctcaagcaccggggcggggatctctccgtaagacgagacctctggtt
gtgaagacgtcgttgaacaacccatacatcatccgctggagcgctctggagagcgaggat
atgcacttcatcctacagacgcttgaggacaggcttaaagctattggacttcagaagatt
gaagataagaagaaaaagaacaaaacaccttttctgaaaaaagaaagcagagagaaatgc
agcattgctgttgatattagtgagaatctgaaggagaagaaaacagatgctaagcagcaa
gtgtcagggtggacgcctgcacacgtcaggaagcagcttgccattggcgttaacgaagtt
accagagccctggaaaggagggaactgctgttagttctggtgtgtaaatcagtcaagcct
gccatgatcacctcacacttgattcagttaagcctaagcagaagtgtccctgcctgtcag
gtcccccggctcagtgagagaatcgcccccgtcattggcttaaaatgtgttctagccttg
gcgttcaaaaagaacaccactgactttgtggacgaagtaagagccatcatccccagagtc
cccagtttaagtgtaccatggcttcaagacagaattgaagattctggggaaaatttagag
actgaacctctggaaagccaagacagagagcttttggacacttcatttgaagatctgtca
aaacctaagagaaagcttgctgacggtcggcaggcttctgtaacattacaaccccttaaa
ataaagaaactgattccaaaccctaataagataaggaaaccacccaaaagtaaaaaagct
actccaaagtaa

DBGET integrated database retrieval system