KEGG   Homo sapiens (human): 10557Help
Entry
10557             CDS       T01001                                 

Gene name
RPP38
Definition
ribonuclease P/MRP 38kDa subunit (EC:3.1.26.5)
Orthology
K14523  
ribonucleases P/MRP protein subunit RPP38 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10557 (RPP38)
   03008 Ribosome biogenesis in eukaryotes
    10557 (RPP38)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     10557 (RPP38)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     10557 (RPP38)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    10557 (RPP38)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    10557 (RPP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p13
AA seq 283 aa AA seqDB search
MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKI
EDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV
TRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLAL
AFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctcctcaagcaccggggcggggatctctccgtaagacgagacctctggtt
gtgaagacgtcgttgaacaacccatacatcatccgctggagcgctctggagagcgaggat
atgcacttcatcctacagacgcttgaggacaggcttaaagctattggacttcagaagatt
gaagataagaagaaaaagaacaaaacaccttttctgaaaaaagaaagcagagagaaatgc
agcattgctgttgatattagtgagaatctgaaggagaagaaaacagatgctaagcagcaa
gtgtcagggtggacgcctgcacacgtcaggaagcagcttgccattggcgttaacgaagtt
accagagccctggaaaggagggaactgctgttagttctggtgtgtaaatcagtcaagcct
gccatgatcacctcacacttgattcagttaagcctaagcagaagtgtccctgcctgtcag
gtcccccggctcagtgagagaatcgcccccgtcattggcttaaaatgtgttctagccttg
gcgttcaaaaagaacaccactgactttgtggacgaagtaagagccatcatccccagagtc
cccagtttaagtgtaccatggcttcaagacagaattgaagattctggggaaaatttagag
actgaacctctggaaagccaagacagagagcttttggacacttcatttgaagatctgtca
aaacctaagagaaagcttgctgacggtcggcaggcttctgtaacattacaaccccttaaa
ataaagaaactgattccaaaccctaataagataaggaaaccacccaaaagtaaaaaagct
actccaaagtaa

DBGET integrated database retrieval system