KEGG   Homo sapiens (human): 10560Help
Entry
10560             CDS       T01001                                 

Gene name
SLC19A2, TC1, THMD1, THT1, THTR1, TRMA
Definition
solute carrier family 19 (thiamine transporter), member 2
Orthology
K14610  
solute carrier family 19 (thiamine transporter), member 2/3
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H01183  
Thiamine-responsive megaloblastic anemia (TRMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    10560 (SLC19A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.3
AA seq 497 aa AA seqDB search
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG
LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD
TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV
WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST
WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK
KCRKLEDPQSSSQVTTS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcccggcccggtgtctcggcgggcggcggcggcggcggccactgtgctcctg
cggaccgctcgggtccgtcgcgaatgctggttcttgccgaccgcgctgctctgcgcctac
ggcttcttcgccagcctcaggccgtccgagcccttcctgaccccgtacctgctggggccg
gacaagaacctgaccgagagggaggtcttcaatgaaatttatccagtatggacttactct
tacctggtgctactgtttcctgtgttccttgccacagactacctccgttataaacctgtt
gttctactgcaggggctcagccttattgttacatggtttatgctgctctatgcccaggga
ctgctggccattcaatttctagaatttttttatggcatcgccacagccactgaaattgcc
tattactcttatatctacagtgtggtggacctgggcatgtaccagaaagtcacaagttac
tgtcgaagtgccactttggtgggctttacagtgggctctgtcctagggcaaatccttgtc
tcagtggcaggctggtcgctgttcagcctgaatgtcatctctcttacctgtgtttcagtg
gcttttgctgtggcctggtttttacctatgccacagaagagcctcttctttcaccacatt
ccttctacctgccagagagtgaatggcatcaaggtacaaaatggtggcattgttactgac
accccagcttctaaccaccttcctggctgggaggacattgagtcaaaaatccctctaaat
atggaggagcctcccgtggaggaaccggaacccaagccagaccgtctccttgtattgaaa
gtactatggaatgatttcctgatgtgctactcctctcgccctcttctctgctggtctgtg
tggtgggccctctctacctgtggctattttcaagttgtgaactacacacagggcctgtgg
gagaaagtgatgccttctcgctatgctgctatctataatggtggcgtggaggccgtttca
accttactgggtgctgttgctgtgtttgcagttggttatataaaaatatcctggtcaact
tggggagaaatgacattatctctcttttctctcctgattgctgctgcagtgtatatcatg
gacactgtgggtaacatttgggtgtgctatgcatcctatgttgtcttcagaatcatctac
atgttactcatcacgatagcaacttttcaaattgctgcaaacctcagcatggaacgctat
gccctagtatttggtgtaaataccttcattgccctggcactgcagacgctgctcactcta
attgtggtagatgccagtggccttggattagaaattaccactcagtttttgatctatgcc
agttattttgcactcatcgctgtggttttcctggccagtggtgcagtcagtgttatgaag
aaatgtagaaagctggaagatccacaatcaagttctcaagtaaccacttcataa

DBGET integrated database retrieval system