KEGG   Homo sapiens (human): 10560Help
Entry
10560             CDS       T01001                                 

Gene name
SLC19A2, TC1, THMD1, THT1, THTR1, TRMA
Definition
(RefSeq) solute carrier family 19 member 2
  KO
K14610  solute carrier family 19 (thiamine transporter), member 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Disease
H01183  Thiamine-responsive megaloblastic anemia (TRMA)
H01565  Wernicke encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    10560 (SLC19A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC19: Folate/thiamine transporter
   10560 (SLC19A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_carrier MFS_1
Motif
Other DBs
NCBI-GeneID: 10560
NCBI-ProteinID: NP_008927
OMIM: 603941
HGNC: 10938
Ensembl: ENSG00000117479
Vega: OTTHUMG00000035452
Pharos: O60779(Tbio)
UniProt: O60779 A0A024R928
Position
1q24.2
AA seq 497 aa AA seqDB search
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG
LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD
TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV
WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST
WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK
KCRKLEDPQSSSQVTTS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcccggcccggtgtctcggcgggcggcggcggcggcggccactgtgctcctg
cggaccgctcgggtccgtcgcgaatgctggttcttgccgaccgcgctgctctgcgcctac
ggcttcttcgccagcctcaggccgtccgagcccttcctgaccccgtacctgctggggccg
gacaagaacctgaccgagagggaggtcttcaatgaaatttatccagtatggacttactct
tacctggtgctactgtttcctgtgttccttgccacagactacctccgttataaacctgtt
gttctactgcaggggctcagccttattgttacatggtttatgctgctctatgcccaggga
ctgctggccattcaatttctagaatttttttatggcatcgccacagccactgaaattgcc
tattactcttatatctacagtgtggtggacctgggcatgtaccagaaagtcacaagttac
tgtcgaagtgccactttggtgggctttacagtgggctctgtcctagggcaaatccttgtc
tcagtggcaggctggtcgctgttcagcctgaatgtcatctctcttacctgtgtttcagtg
gcttttgctgtggcctggtttttacctatgccacagaagagcctcttctttcaccacatt
ccttctacctgccagagagtgaatggcatcaaggtacaaaatggtggcattgttactgac
accccagcttctaaccaccttcctggctgggaggacattgagtcaaaaatccctctaaat
atggaggagcctcccgtggaggaaccggaacccaagccagaccgtctccttgtattgaaa
gtactatggaatgatttcctgatgtgctactcctctcgccctcttctctgctggtctgtg
tggtgggccctctctacctgtggctattttcaagttgtgaactacacacagggcctgtgg
gagaaagtgatgccttctcgctatgctgctatctataatggtggcgtggaggccgtttca
accttactgggtgctgttgctgtgtttgcagttggttatataaaaatatcctggtcaact
tggggagaaatgacattatctctcttttctctcctgattgctgctgcagtgtatatcatg
gacactgtgggtaacatttgggtgtgctatgcatcctatgttgtcttcagaatcatctac
atgttactcatcacgatagcaacttttcaaattgctgcaaacctcagcatggaacgctat
gccctagtatttggtgtaaataccttcattgccctggcactgcagacgctgctcactcta
attgtggtagatgccagtggccttggattagaaattaccactcagtttttgatctatgcc
agttattttgcactcatcgctgtggttttcctggccagtggtgcagtcagtgttatgaag
aaatgtagaaagctggaagatccacaatcaagttctcaagtaaccacttcataa

DBGET integrated database retrieval system