KEGG   Homo sapiens (human): 10563Help
Entry
10563             CDS       T01001                                 

Gene name
CXCL13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Definition
chemokine (C-X-C motif) ligand 13
Orthology
K10032  
C-X-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 109 aa AA seqDB search
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatctcgacatctctgcttctcatgctgctggtcagcagcctctctccagtc
caaggtgttctggaggtctattacacaagcttgaggtgtagatgtgtccaagagagctca
gtctttatccctagacgcttcattgatcgaattcaaatcttgccccgtgggaatggttgt
ccaagaaaagaaatcatagtctggaagaagaacaagtcaattgtgtgtgtggaccctcaa
gctgaatggatacaaagaatgatggaagtattgagaaaaagaagttcttcaactctacca
gttccagtgtttaagagaaagattccctga

DBGET integrated database retrieval system