KEGG   Homo sapiens (human): 10568Help
Entry
10568             CDS       T01001                                 

Gene name
SLC34A2, NAPI-3B, NAPI-IIb, NPTIIb
Definition
(RefSeq) solute carrier family 34 member 2
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H01298  Pulmonary alveolar microlithiasis (PALM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10568 (SLC34A2)
  Digestive system
   04978 Mineral absorption
    10568 (SLC34A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   10568 (SLC34A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   10568 (SLC34A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_Pi_cotrans
Motif
Other DBs
NCBI-GeneID: 10568
NCBI-ProteinID: NP_006415
OMIM: 604217
HGNC: 11020
Ensembl: ENSG00000157765
Vega: OTTHUMG00000097757
Pharos: O95436(Tbio)
UniProt: O95436
Position
4p15.2
AA seq 690 aa AA seqDB search
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI
DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS
AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY
LEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK
IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSL
KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVK
APETFDNITISREAQGEVPASDSKTECTAL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctccctggcctgaattgggagatgcccagcccaaccccgataagtacctcgaaggg
gccgcaggtcagcagcccactgcccctgataaaagcaaagagaccaacaaaacagataac
actgaggcacctgtaaccaagattgaacttctgccgtcctactccacggctacactgata
gatgagcccactgaggtggatgacccctggaacctacccactcttcaggactcggggatc
aagtggtcagagagagacaccaaagggaagattctctgtttcttccaagggattgggaga
ttgattttacttctcggatttctctactttttcgtgtgctccctggatattcttagtagc
gccttccagctggttggaggaaaaatggcaggacagttcttcagcaacagctctattatg
tccaaccctttgttggggctggtgatcggggtgctggtgaccgtcttggtgcagagctcc
agcacctcaacgtccatcgttgtcagcatggtgtcctcttcattgctcactgttcgggct
gccatccccattatcatgggggccaacattggaacgtcaatcaccaacactattgttgcg
ctcatgcaggtgggagatcggagtgagttcagaagagcttttgcaggagccactgtccat
gacttcttcaactggctgtccgtgttggtgctcttgcccgtggaggtggccacccattac
ctcgagatcataacccagcttatagtggagagcttccacttcaagaatggagaagatgcc
ccagatcttctgaaagtcatcactaagcccttcacaaagctcattgtccagctggataaa
aaagttatcagccaaattgcaatgaacgatgaaaaagcgaaaaacaagagtcttgtcaag
atttggtgcaaaacttttaccaacaagacccagattaacgtcactgttccctcgactgct
aactgcacctccccttccctctgttggacggatggcatccaaaactggaccatgaagaat
gtgacctacaaggagaacatcgccaaatgccagcatatctttgtgaatttccacctcccg
gatcttgctgtgggcaccatcttgctcatactctccctgctggtcctctgtggttgcctg
atcatgattgtcaagatcctgggctctgtgctcaaggggcaggtcgccactgtcatcaag
aagaccatcaacactgatttcccctttccctttgcatggttgactggctacctggccatc
ctcgtcggggcaggcatgaccttcatcgtacagagcagctctgtgttcacgtcggccttg
acccccctgattggaatcggcgtgataaccattgagagggcttatccactcacgctgggc
tccaacatcggcaccaccaccaccgccatcctggccgccttagccagccctggcaatgca
ttgaggagttcactccagatcgccctgtgccactttttcttcaacatctccggcatcttg
ctgtggtacccgatcccgttcactcgcctgcccatccgcatggccaaggggctgggcaac
atctctgccaagtatcgctggttcgccgtcttctacctgatcatcttcttcttcctgatc
ccgctgacggtgtttggcctctcgctggccggctggcgggtgctggttggtgtcggggtt
cccgtcgtcttcatcatcatcctggtactgtgcctccgactcctgcagtctcgctgccca
cgcgtcctgccgaagaaactccagaactggaacttcctgccgctgtggatgcgctcgctg
aagccctgggatgccgtcgtctccaagttcaccggctgcttccagatgcgctgctgctgc
tgctgccgcgtgtgctgccgcgcgtgctgcttgctgtgtggctgccccaagtgctgccgc
tgcagcaagtgctgcgaggacttggaggaggcgcaggaggggcaggatgtccctgtcaag
gctcctgagacctttgataacataaccattagcagagaggctcagggtgaggtccctgcc
tcggactcaaagaccgaatgcacggccttgtag

DBGET integrated database retrieval system