KEGG   Homo sapiens (human): 10568Help
Entry
10568             CDS       T01001                                 

Gene name
SLC34A2, NAPI-3B, NAPI-IIb, NPTIIb
Definition
solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Orthology
K14683  
solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Disease
H00014  
Non-small cell lung cancer
H01298  
Pulmonary alveolar microlithiasis (PALM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    10568 (SLC34A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   10568 (SLC34A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.2
AA seq 689 aa AA seqDB search
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLPSYSTATLID
EPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSSA
FQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRAA
IPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHYL
EIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKI
WCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPD
LAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAIL
VGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNAL
RSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLIP
LTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSLK
PWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKA
PETFDNITISREAQGEVPASDSKTECTAL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctccctggcctgaattgggagatgcccagcccaaccccgataagtacctcgaaggg
gccgcaggtcagcagcccactgcccctgataaaagcaaagagaccaacaaaaataacact
gaggcacctgtaaccaagattgaacttctgccgtcctactccacggctacactgatagat
gagcccactgaggtggatgacccctggaacctacccactcttcaggactcggggatcaag
tggtcagagagagacaccaaagggaagattctctgtttcttccaagggattgggagattg
attttacttctcggatttctctactttttcgtgtgctccctggatattcttagtagcgcc
ttccagctggttggaggaaaaatggcaggacagttcttcagcaacagctctattatgtcc
aaccctttgttggggctggtgatcggggtgctggtgaccgtcttggtgcagagctccagc
acctcaacgtccatcgttgtcagcatggtgtcctcttcattgctcactgttcgggctgcc
atccccattatcatgggggccaacattggaacgtcaatcaccaacactattgttgcgctc
atgcaggtgggagatcggagtgagttcagaagagcttttgcaggagccactgtccatgac
ttcttcaactggctgtccgtgttggtgctcttgcccgtggaggtggccacccattacctc
gagatcataacccagcttatagtggagagcttccacttcaagaatggagaagatgcccca
gatcttctgaaagtcatcactaagcccttcacaaagctcattgtccagctggataaaaaa
gttatcagccaaattgcaatgaacgatgaaaaagcgaaaaacaagagtcttgtcaagatt
tggtgcaaaacttttaccaacaagacccagattaacgtcactgttccctcgactgctaac
tgcacctccccttccctctgttggacggatggcatccaaaactggaccatgaagaatgtg
acctacaaggagaacatcgccaaatgccagcatatctttgtgaatttccacctcccggat
cttgctgtgggcaccatcttgctcatactctccctgctggtcctctgtggttgcctgatc
atgattgtcaagatcctgggctctgtgctcaaggggcaggtcgccactgtcatcaagaag
accatcaacactgatttcccctttccctttgcatggttgactggctacctggccatcctc
gtcggggcaggcatgaccttcatcgtacagagcagctctgtgttcacgtcggccttgacc
cccctgattggaatcggcgtgataaccattgagagggcttatccactcacgctgggctcc
aacatcggcaccaccaccaccgccatcctggccgccttagccagccctggcaatgcattg
aggagttcactccagatcgccctgtgccactttttcttcaacatctccggcatcttgctg
tggtacccgatcccgttcactcgcctgcccatccgcatggccaaggggctgggcaacatc
tctgccaagtatcgctggttcgccgtcttctacctgatcatcttcttcttcctgatcccg
ctgacggtgtttggcctctcgctggccggctggcgggtgctggttggtgtcggggttccc
gtcgtcttcatcatcatcctggtactgtgcctccgactcctgcagtctcgctgcccacgc
gtcctgccgaagaaactccagaactggaacttcctgccgctgtggatgcgctcgctgaag
ccctgggatgccgtcgtctccaagttcaccggctgcttccagatgcgctgctgctgctgc
tgccgcgtgtgctgccgcgcgtgctgcttgctgtgtggctgccccaagtgctgccgctgc
agcaagtgctgcgaggacttggaggaggcgcaggaggggcaggatgtccctgtcaaggct
cctgagacctttgataacataaccattagcagagaggctcagggtgaggtccctgcctcg
gactcaaagaccgaatgcacggccttgtag

DBGET integrated database retrieval system