KEGG   Homo sapiens (human): 10569Help
Entry
10569             CDS       T01001                                 

Gene name
SLU7, 9G8, hSlu7
Definition
(RefSeq) SLU7 homolog, splicing factor
  KO
K12819  pre-mRNA-processing factor SLU7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10569 (SLU7)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    10569 (SLU7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Slu7 zf-CCHC_4 zf-CCHC
Motif
Other DBs
NCBI-GeneID: 10569
NCBI-ProteinID: NP_006416
OMIM: 605974
HGNC: 16939
Ensembl: ENSG00000164609
Vega: OTTHUMG00000130324
Pharos: O95391(Tbio)
UniProt: O95391
Position
5q33.3
AA seq 586 aa AA seqDB search
MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN
PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGAC
ENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDE
DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVK
KEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE
EDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESV
KKPQTLMELHQEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVK
ETMQIDERKRPYNSMYETREPTEEEMEAYRMKRQRPDDPMASFLGQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccacagttgtagatgcagttaatgctgcacccctatcggggtccaaagaaatg
agtttggaagaaccaaagaagatgaccagagaggactggagaaagaagaaggagctagaa
gaacagcgaaaattgggcaatgctcctgcagaagttgatgaagaaggaaaagacatcaac
ccccatattcctcagtatatttcttcagtgccatggtatattgatccttcaaaaagacct
actttaaaacaccagagaccacaaccagaaaaacaaaagcagttcagctcatctggagaa
tggtacaagaggggtgtaaaagagaattccataattactaagtaccgcaaaggagcatgt
gaaaattgtggggccatgacacacaaaaagaaagactgctttgagagacctaggcgagtt
ggagccaaatttacaggtactaatatagctccagatgaacatgtccagcctcaactgatg
tttgactatgatgggaagagggatcggtggaatggctacaatccagaagaacacatgaaa
attgttgaagagtatgccaaagttgatttggcaaaacgaacattgaaagcccagaaactc
caagaggaattagcctcaggaaaattagtggaacaggctaattctccaaaacaccagtgg
ggagaagaggaaccaaattctcagatggaaaaagatcataatagtgaagatgaggatgaa
gataaatatgcagatgatattgacatgcctggacagaattttgactccaagagacgaatt
actgtccggaatctcaggattcgagaagatattgcaaaatatttgaggaatttagatcca
aattctgcctactatgatccaaaaactagagcaatgagagagaatccttatgccaatgca
ggaaagaatccagatgaagtgagttatgctggagataactttgttaggtacacaggagat
accatttcaatggctcagacacagttgtttgcatgggaagcctatgacaagggatctgaa
gtgcatctacaggcagatcctacaaagctagagctgttgtataagtccttcaaagtcaaa
aaagaagatttcaaagaacagcagaaagaaagcatcctggaaaagtatggtggccaagaa
catttggatgcccctccagctgaattgcttttagcccagactgaagactatgtggagtac
tcaagacatgggacagtcatcaaaggacaggagcgggctgttgcctgctctaagtatgag
gaggatgtgaagatccacaatcacacacatatctggggatcgtactggaaagaaggccga
tggggatacaaatgctgtcactcttttttcaagtattcctattgtactggagaagctggg
aaggagattgttaactctgaggagtgtattataaatgagataactggggaagaatctgtg
aaaaaacctcaaaccctcatggagctgcatcaagaaaaactgaaagaggaaaagaagaag
aagaaaaagaaaaagaagaagcatcgaaagagcagttcagatagtgatgatgaagaaaag
aagcatgaaaaattgaaaaaggcactgaacgcagaggaggcccgccttcttcatgtcaag
gagaccatgcagattgatgagaggaagcggccttacaatagcatgtatgaaactcgagaa
cctactgaagaggaaatggaggcatatagaatgaaacgtcagaggccagatgaccccatg
gcctctttccttggacagtag

DBGET integrated database retrieval system