KEGG   Homo sapiens (human): 10569Help
Entry
10569             CDS       T01001                                 

Gene name
SLU7, 9G8, hSlu7
Definition
SLU7 splicing factor homolog (S. cerevisiae)
Orthology
K12819  
pre-mRNA-processing factor SLU7
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.3
AA seq 586 aa AA seqDB search
MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDIN
PHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGAC
ENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMK
IVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDE
DKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVK
KEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE
EDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESV
KKPQTLMELHQEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVK
ETMQIDERKRPYNSMYETREPTEEEMEAYRMKRQRPDDPMASFLGQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccacagttgtagatgcagttaatgctgcacccctatcggggtccaaagaaatg
agtttggaagaaccaaagaagatgaccagagaggactggagaaagaagaaggagctagaa
gaacagcgaaaattgggcaatgctcctgcagaagttgatgaagaaggaaaagacatcaac
ccccatattcctcagtatatttcttcagtgccatggtatattgatccttcaaaaagacct
actttaaaacaccagagaccacaaccagaaaaacaaaagcagttcagctcatctggagaa
tggtacaagaggggtgtaaaagagaattccataattactaagtaccgcaaaggagcatgt
gaaaattgtggggccatgacacacaaaaagaaagactgctttgagagacctaggcgagtt
ggagccaaatttacaggtactaatatagctccagatgaacatgtccagcctcaactgatg
tttgactatgatgggaagagggatcggtggaatggctacaatccagaagaacacatgaaa
attgttgaagagtatgccaaagttgatttggcaaaacgaacattgaaagcccagaaactc
caagaggaattagcctcaggaaaattagtggaacaggctaattctccaaaacaccagtgg
ggagaagaggaaccaaattctcagatggaaaaagatcataatagtgaagatgaggatgaa
gataaatatgcagatgatattgacatgcctggacagaattttgactccaagagacgaatt
actgtccggaatctcaggattcgagaagatattgcaaaatatttgaggaatttagatcca
aattctgcctactatgatccaaaaactagagcaatgagagagaatccttatgccaatgca
ggaaagaatccagatgaagtgagttatgctggagataactttgttaggtacacaggagat
accatttcaatggctcagacacagttgtttgcatgggaagcctatgacaagggatctgaa
gtgcatctacaggcagatcctacaaagctagagctgttgtataagtccttcaaagtcaaa
aaagaagatttcaaagaacagcagaaagaaagcatcctggaaaagtatggtggccaagaa
catttggatgcccctccagctgaattgcttttagcccagactgaagactatgtggagtac
tcaagacatgggacagtcatcaaaggacaggagcgggctgttgcctgctctaagtatgag
gaggatgtgaagatccacaatcacacacatatctggggatcgtactggaaagaaggccga
tggggatacaaatgctgtcactcttttttcaagtattcctattgtactggagaagctggg
aaggagattgttaactctgaggagtgtattataaatgagataactggggaagaatctgtg
aaaaaacctcaaaccctcatggagctgcatcaagaaaaactgaaagaggaaaagaagaag
aagaaaaagaaaaagaagaagcatcgaaagagcagttcagatagtgatgatgaagaaaag
aagcatgaaaaattgaaaaaggcactgaacgcagaggaggcccgccttcttcatgtcaag
gagaccatgcagattgatgagaggaagcggccttacaatagcatgtatgaaactcgagaa
cctactgaagaggaaatggaggcatatagaatgaaacgtcagaggccagatgaccccatg
gcctctttccttggacagtag

DBGET integrated database retrieval system