KEGG   Homo sapiens (human): 10580Help
Entry
10580             CDS       T01001                                 

Gene name
SORBS1, CAP, FLAF2, R85FL, SH3D5, SH3P12, SORB1
Definition
sorbin and SH3 domain containing 1
Orthology
K06086  
sorbin and SH3 domain containing 1
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Adherens junction
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04520 Adherens junction
    10580 (SORBS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    10580 (SORBS1)
   03320 PPAR signaling pathway
    10580 (SORBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.33
AA seq 1292 aa AA seqDB search
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
PTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAK
DDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQP
GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
KTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHA
VKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
LNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQV
DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHS
KLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDH
LALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGV
HTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGP
GGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGE
QAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgaatgtgatggtggttccaaagctgtgatgaatggcttggcacctggcagc
aatgggcaagacaaagcaactgccgaccctttacgcgcacgctctatttctgctgttaaa
atcattcctgtgaagacagtgaaaaacgcctcaggcctagttctccctacagacatggat
cctacaaaaatctgcactgggaagggagcggtgactctccgggcctcgtcttcctacagg
gaaaccccaagcagtagccctgcgagccctcaggaaacccggcaacacgaaagcaaacca
ggtctggagccagagccttcttcagcagatgagtggaggctttcttccagtgctgatgcc
aatggaaatgcccagccctcttcactcgctgccaagggctacagaagtgtgcatcccaac
cttccttctgacaagtcccaggatgccacttcctccagtgcagcccagccggaggtaata
gttgtccctctctacctggttaatactgacagagggcaagaaggcactgccagacctcca
acacctctggggcctcttggctgcgtccccacaatcccagcgactgcctctgccgcctca
cctctgaccttcccgactctagatgatttcattccccctcatctgcagaggtggccccac
cacagccagccagcccgcgcctctggctcctttgcccccattagccagacgccaccatcc
ttctcaccaccacctccgctggtccctcctgccccggaggacctccgcagagtctcggag
cctgacctcacgggagctgtttcgagtaccgattccagtcctctactaaatgaagtttct
tcttcccttattggaactgattcccaagcctttccatcagttagcaagccttcatccgcc
tatccctccacaacgattgtcaatcctactattgtgctcttgcaacacaatcgagaacag
caaaaacgactcagtagcctttcagatcctgtctcagaaagaagagtgggagagcaggac
tcagcaccaacccaggaaaaacccacctcacctggcaaggctattgaaaaaagagcaaag
gatgacagtaggcgggtggtgaagagcactcaggacttaagcgatgtttccatggatgaa
gtgggcatcccactccggaacactgagagatcaaaagactggtacaagactatgtttaaa
cagatccacaaactgaacagagacactcctgaagaaaacccttatttccctacgtacaaa
ttccctgaacttcctgaaatccagcaaacttccgaagaggacaatccttacactcccacc
taccagtttcctgcatctactcctagtcctaaatctgaagatgatgattcagatctgtac
tctcccagatactcattttctgaagacacaaaatctcccctttctgtgcctcgctcaaaa
agtgagatgagctacattgatggtgagaaggtagtcaagaggtcggccacactacccctc
ccagcccgctcttcctcactgaagtcaagctcagaaagaaatgactgggaacccccagat
aagaaagtagacacaagaaaatatcgtgcagagcccaagagcatttacgaatatcagcct
ggcaagtcttccgttctgaccaacgaaaagatgagtcgggatataagcccagaagagata
gatttaaagaatgaaccttggtataaattcttttcggaattggagtttgggaaaccgcct
cccaaaaagatatgggattatactcctggagactgctctatccttcctagagaggataga
aagactaatctagacaaagatctcagcctctgccagacagagttagaggcagatttagaa
aaaatggagacgcttaataaagcacccagtgcaaacgtgccacagagctcagccatcagc
cctactccggaaatttcttcagagactcctggatatatatattcttccaacttccatgca
gtgaagagggaatcagacggggctcctggggatctcactagcttggagaatgagagacaa
atttataaaagtgtcttggaaggtggtgacatccctcttcagggcctgagtgggctcaag
cgaccatccagctctgcttccactaaagattcagaatcgccaagacattttataccagct
gattacttggaatccacggaagaatttattcgaagacgtcatgatgataaagagaaactt
ttagcggaccagagacgacttaaacgcgagcaagaagaggctgatattgcagctcgacgc
cacacaggcgtcattccgacgcaccatcagtttatcactaatgagcgctttggggacctc
ctcaatatagacgatactgcaaaaaggaaatctgggtcagagatgagacctgccagagcc
aaatttgactttaaagctcagacactaaaggagcttcctctgcagaagggagatattgtt
tacatttataagcaaattgatcagaactggtatgaaggagaacaccacggccgggtggga
atcttcccacgcacctacatcgagcttcttcctcctgctgagaaggcacagcccaaaaag
ttgacaccagtgcaggttttggaatatggagaagctattgctaagtttaactttaatggt
gatacacaagtagaaatgtccttcagaaagggtgagaggatcacactgctccggcaggta
gatgagaactggtacgaagggaggatcccggggacatcccgacaaggcatcttccccatc
acctacgtggatgtgatcaagcgaccactggtgaaaaaccctgtggattacatggacctg
cctttctcctcctccccaagtcgcagtgccactgcaagcccacagttttccagtcacagc
aagctcatcacgccagccccctcatctctgccccactcccgccgagccctgtcccccgag
atgcacgctgtcacctctgagtggatctcactgactgtgggggtcccaggcaggcgttct
ctggccctgaccccacccttgcctcctctgccagaggcttctatctataacactgaccac
ctcgccttgtcaccaagggccagtccctccctgtctctcagcctcccccatttgagttgg
tcagatcgtcccaccccacgatcagtagcttctccactggccctaccttccccacacaaa
acctactccctagcacctacttcccaggcctcccttcacatgaatggagacggtggtgtc
cacacgccatcttcaggcatccaccaagatagcttcttgcagctgccgctggggagctct
gatagtgtcatctcccagcttagtgatgcctttagcagccagagcaagaggcagccatgg
cgcgaagagagtggacaatatgagaggaaagcagagaggggggcaggcgaaagaggccct
ggtggacccaagatctctaagaagagctgcttgaagccttcagacgtggtcaggtgcctg
agtactgaacagagactctcagatctcaacacccctgaggagagccggcccggcaagccc
ctgggtagcgcttttccaggaagtgaggctgagcagacagagcggcatagaggtggcgag
caggcggggaggaaagctgctcggagaggtgggagccagcaacctcaagcccagcagcga
agagtcacccccgacaggagtcaaacctcacaagatttatttagctatcaagcattatat
agctatataccacagaatgatgatgagttggaactccgcgatggagatatcgttgatgtc
atggaaaaatgtgacgatggatggtttgttggtacttcaagaaggacaaagcagtttggt
acttttccaggcaactatgtaaaacctttgtatctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system