KEGG   Homo sapiens (human): 10580Help
Entry
10580             CDS       T01001                                 

Gene name
SORBS1, CAP, FLAF2, R85FL, SH3D5, SH3P12, SORB1
Definition
(RefSeq) sorbin and SH3 domain containing 1
  KO
K06086  sorbin and SH3 domain containing 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    10580 (SORBS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    10580 (SORBS1)
   03320 PPAR signaling pathway
    10580 (SORBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Motif
Other DBs
NCBI-GeneID: 10580
NCBI-ProteinID: NP_001030126
OMIM: 605264
HGNC: 14565
Ensembl: ENSG00000095637
Vega: OTTHUMG00000018812
Pharos: Q9BX66(Tbio)
UniProt: Q9BX66
Structure
PDB: 

Jmol
Position
10q24.1
AA seq 1292 aa AA seqDB search
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMD
PTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPP
TPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPS
FSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSA
YPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAK
DDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK
FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSK
SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQP
GKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDR
KTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHA
VKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPA
DYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDL
LNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQV
DENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHS
KLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDH
LALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGV
HTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGP
GGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGE
QAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV
MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgaatgtgatggtggttccaaagctgtgatgaatggcttggcacctggcagc
aatgggcaagacaaagcaactgccgaccctttacgcgcacgctctatttctgctgttaaa
atcattcctgtgaagacagtgaaaaacgcctcaggcctagttctccctacagacatggat
cctacaaaaatctgcactgggaagggagcggtgactctccgggcctcgtcttcctacagg
gaaaccccaagcagtagccctgcgagccctcaggaaacccggcaacacgaaagcaaacca
ggtctggagccagagccttcttcagcagatgagtggaggctttcttccagtgctgatgcc
aatggaaatgcccagccctcttcactcgctgccaagggctacagaagtgtgcatcccaac
cttccttctgacaagtcccaggatgccacttcctccagtgcagcccagccggaggtaata
gttgtccctctctacctggttaatactgacagagggcaagaaggcactgccagacctcca
acacctctggggcctcttggctgcgtccccacaatcccagcgactgcctctgccgcctca
cctctgaccttcccgactctagatgatttcattccccctcatctgcagaggtggccccac
cacagccagccagcccgcgcctctggctcctttgcccccattagccagacgccaccatcc
ttctcaccaccacctccgctggtccctcctgccccggaggacctccgcagagtctcggag
cctgacctcacgggagctgtttcgagtaccgattccagtcctctactaaatgaagtttct
tcttcccttattggaactgattcccaagcctttccatcagttagcaagccttcatccgcc
tatccctccacaacgattgtcaatcctactattgtgctcttgcaacacaatcgagaacag
caaaaacgactcagtagcctttcagatcctgtctcagaaagaagagtgggagagcaggac
tcagcaccaacccaggaaaaacccacctcacctggcaaggctattgaaaaaagagcaaag
gatgacagtaggcgggtggtgaagagcactcaggacttaagcgatgtttccatggatgaa
gtgggcatcccactccggaacactgagagatcaaaagactggtacaagactatgtttaaa
cagatccacaaactgaacagagacactcctgaagaaaacccttatttccctacgtacaaa
ttccctgaacttcctgaaatccagcaaacttccgaagaggacaatccttacactcccacc
taccagtttcctgcatctactcctagtcctaaatctgaagatgatgattcagatctgtac
tctcccagatactcattttctgaagacacaaaatctcccctttctgtgcctcgctcaaaa
agtgagatgagctacattgatggtgagaaggtagtcaagaggtcggccacactacccctc
ccagcccgctcttcctcactgaagtcaagctcagaaagaaatgactgggaacccccagat
aagaaagtagacacaagaaaatatcgtgcagagcccaagagcatttacgaatatcagcct
ggcaagtcttccgttctgaccaacgaaaagatgagtcgggatataagcccagaagagata
gatttaaagaatgaaccttggtataaattcttttcggaattggagtttgggaaaccgcct
cccaaaaagatatgggattatactcctggagactgctctatccttcctagagaggataga
aagactaatctagacaaagatctcagcctctgccagacagagttagaggcagatttagaa
aaaatggagacgcttaataaagcacccagtgcaaacgtgccacagagctcagccatcagc
cctactccggaaatttcttcagagactcctggatatatatattcttccaacttccatgca
gtgaagagggaatcagacggggctcctggggatctcactagcttggagaatgagagacaa
atttataaaagtgtcttggaaggtggtgacatccctcttcagggcctgagtgggctcaag
cgaccatccagctctgcttccactaaagattcagaatcgccaagacattttataccagct
gattacttggaatccacggaagaatttattcgaagacgtcatgatgataaagagaaactt
ttagcggaccagagacgacttaaacgcgagcaagaagaggctgatattgcagctcgacgc
cacacaggcgtcattccgacgcaccatcagtttatcactaatgagcgctttggggacctc
ctcaatatagacgatactgcaaaaaggaaatctgggtcagagatgagacctgccagagcc
aaatttgactttaaagctcagacactaaaggagcttcctctgcagaagggagatattgtt
tacatttataagcaaattgatcagaactggtatgaaggagaacaccacggccgggtggga
atcttcccacgcacctacatcgagcttcttcctcctgctgagaaggcacagcccaaaaag
ttgacaccagtgcaggttttggaatatggagaagctattgctaagtttaactttaatggt
gatacacaagtagaaatgtccttcagaaagggtgagaggatcacactgctccggcaggta
gatgagaactggtacgaagggaggatcccggggacatcccgacaaggcatcttccccatc
acctacgtggatgtgatcaagcgaccactggtgaaaaaccctgtggattacatggacctg
cctttctcctcctccccaagtcgcagtgccactgcaagcccacagttttccagtcacagc
aagctcatcacgccagccccctcatctctgccccactcccgccgagccctgtcccccgag
atgcacgctgtcacctctgagtggatctcactgactgtgggggtcccaggcaggcgttct
ctggccctgaccccacccttgcctcctctgccagaggcttctatctataacactgaccac
ctcgccttgtcaccaagggccagtccctccctgtctctcagcctcccccatttgagttgg
tcagatcgtcccaccccacgatcagtagcttctccactggccctaccttccccacacaaa
acctactccctagcacctacttcccaggcctcccttcacatgaatggagacggtggtgtc
cacacgccatcttcaggcatccaccaagatagcttcttgcagctgccgctggggagctct
gatagtgtcatctcccagcttagtgatgcctttagcagccagagcaagaggcagccatgg
cgcgaagagagtggacaatatgagaggaaagcagagaggggggcaggcgaaagaggccct
ggtggacccaagatctctaagaagagctgcttgaagccttcagacgtggtcaggtgcctg
agtactgaacagagactctcagatctcaacacccctgaggagagccggcccggcaagccc
ctgggtagcgcttttccaggaagtgaggctgagcagacagagcggcatagaggtggcgag
caggcggggaggaaagctgctcggagaggtgggagccagcaacctcaagcccagcagcga
agagtcacccccgacaggagtcaaacctcacaagatttatttagctatcaagcattatat
agctatataccacagaatgatgatgagttggaactccgcgatggagatatcgttgatgtc
atggaaaaatgtgacgatggatggtttgttggtacttcaagaaggacaaagcagtttggt
acttttccaggcaactatgtaaaacctttgtatctataa

DBGET integrated database retrieval system