KEGG   Homo sapiens (human): 10587Help
Entry
10587             CDS       T01001                                 

Gene name
TXNRD2, SELZ, TR, TR-BETA, TR3, TRXR2
Definition
thioredoxin reductase 2 (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    10587 (TXNRD2)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    10587 (TXNRD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     10587 (TXNRD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 338 aa AA seqDB search
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
TGKEDTGTFDTVLWAIAPCISACLPTTVGHAGKNQRRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaatggcggtggcgctgcggggattaggagggcgcttccggtggcggacgcag
gccgtggcgggcggggtgcggggcgcggcgcggggcgcagcagcaggtcagcgggactat
gatctcctggtggtcggcgggggatctggtggcctggcttgtgccaaggaggccgcccag
ctgggaaggaaggtggccgtggtggactacgtggaaccttctccccaaggcacccggtgg
ggcctcggcggcacctgcgtcaacgtgggctgcatccccaagaagctgatgcaccaggcg
gcactgctgggaggcctgatccaagatgcccccaactatggctgggaggtggcccagccc
gtgccgcatgactggaggaagatggcagaagctgttcaaaatcacgtgaaatccttgaac
tggggccaccgtgtccagcttcaggacagaaaagtcaagtactttaacatcaaagccagc
tttgttgacgagcacacggtttgcggcgttgccaaaggtgggaaagagattctgctgtca
gccgatcacatcatcattgctactggagggcggccgagataccccacgcacatcgaaggt
gccttggaatatggaatcacaagtgatgacatcttctggctgaaggaatcccctggaaaa
acgttggtggtcggggccagctatgtggccctggagtgtgctggcttcctcaccgggatt
gggctggacaccaccatcatgatgcgcagcatccccctccgcggcttcgaccagcaaatg
tcctccatggtcatagagcacatggcatctcatggcacccggttcctgaggggctgtgcc
ccctcgcgggtcaggaggctccctgatggccagctgcaggtcacctgggaggacagcacc
accggcaaggaggacacgggcacctttgacaccgtcctgtgggccatagcaccttgcatc
tctgcgtgtctccccaccaccgtgggacatgctggaaaaaaccagagaagagactga

DBGET integrated database retrieval system