KEGG   Homo sapiens (human): 10587Help
Entry
10587             CDS       T01001                                 

Gene name
TXNRD2, SELZ, TR, TR-BETA, TR3, TRXR2
Definition
thioredoxin reductase 2 (EC:1.8.1.9)
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hsa00450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 338 aa AA seqDB search
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
TGKEDTGTFDTVLWAIAPCISACLPTTVGHAGKNQRRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaatggcggtggcgctgcggggattaggagggcgcttccggtggcggacgcag
gccgtggcgggcggggtgcggggcgcggcgcggggcgcagcagcaggtcagcgggactat
gatctcctggtggtcggcgggggatctggtggcctggcttgtgccaaggaggccgcccag
ctgggaaggaaggtggccgtggtggactacgtggaaccttctccccaaggcacccggtgg
ggcctcggcggcacctgcgtcaacgtgggctgcatccccaagaagctgatgcaccaggcg
gcactgctgggaggcctgatccaagatgcccccaactatggctgggaggtggcccagccc
gtgccgcatgactggaggaagatggcagaagctgttcaaaatcacgtgaaatccttgaac
tggggccaccgtgtccagcttcaggacagaaaagtcaagtactttaacatcaaagccagc
tttgttgacgagcacacggtttgcggcgttgccaaaggtgggaaagagattctgctgtca
gccgatcacatcatcattgctactggagggcggccgagataccccacgcacatcgaaggt
gccttggaatatggaatcacaagtgatgacatcttctggctgaaggaatcccctggaaaa
acgttggtggtcggggccagctatgtggccctggagtgtgctggcttcctcaccgggatt
gggctggacaccaccatcatgatgcgcagcatccccctccgcggcttcgaccagcaaatg
tcctccatggtcatagagcacatggcatctcatggcacccggttcctgaggggctgtgcc
ccctcgcgggtcaggaggctccctgatggccagctgcaggtcacctgggaggacagcacc
accggcaaggaggacacgggcacctttgacaccgtcctgtgggccatagcaccttgcatc
tctgcgtgtctccccaccaccgtgggacatgctggaaaaaaccagagaagagactga

DBGET integrated database retrieval system