KEGG   Homo sapiens (human): 10588Help
Entry
10588             CDS       T01001                                 

Gene name
MTHFS, HsT19268
Definition
(RefSeq) 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
  KO
K01934  
5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10588 (MTHFS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     10588 (MTHFS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q25.1
AA seq 203 aa AA seqDB search
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQD
EIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVR
EEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC
LQVPVNENDMKVDEVLYEDSSTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcggtgagcagcgccaagcggagcctgcggggagagctgaagcagcgt
ctgcgggcgatgagtgccgaggagcggctacgccagtcccgcgtactgagccagaaggtg
attgcccacagtgagtatcaaaagtccaaaagaatttccatctttctgagcatgcaagat
gaaattgagacagaagagatcatcaaggacattttccaacgaggcaaaatctgcttcatc
cctcggtaccggttccagagcaatcacatggatatggtgagaatagaatcaccagaggaa
atttctttacttcccaaaacatcctggaatatccctcagcctggtgagggtgatgttcgg
gaggaggccttgtccacagggggacttgatctcatcttcatgccaggccttgggtttgac
aaacatggcaaccgactggggaggggcaagggctactatgatgcctatctgaagcgctgt
ttgcagcatcaggaagtgaagccctacaccctggcgttggctttcaaagaacagatttgc
ctccaggtcccagtgaatgaaaacgacatgaaggtagatgaagtcctttacgaagactcg
tcaacagcttaa

DBGET integrated database retrieval system