KEGG   Homo sapiens (human): 10588Help
Entry
10588             CDS       T01001                                 

Gene name
MTHFS, HsT19268
Definition
(RefSeq) methenyltetrahydrofolate synthetase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10588 (MTHFS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     10588 (MTHFS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5-FTHF_cyc-lig
Motif
Other DBs
NCBI-GeneID: 10588
NCBI-ProteinID: NP_006432
OMIM: 604197
HGNC: 7437
Ensembl: ENSG00000136371
Vega: OTTHUMG00000144174
Pharos: P49914(Tbio)
UniProt: P49914
Structure
PDB: 

Jmol
Position
15q25.1
AA seq 203 aa AA seqDB search
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQD
EIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVR
EEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC
LQVPVNENDMKVDEVLYEDSSTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcggtgagcagcgccaagcggagcctgcggggagagctgaagcagcgt
ctgcgggcgatgagtgccgaggagcggctacgccagtcccgcgtactgagccagaaggtg
attgcccacagtgagtatcaaaagtccaaaagaatttccatctttctgagcatgcaagat
gaaattgagacagaagagatcatcaaggacattttccaacgaggcaaaatctgcttcatc
cctcggtaccggttccagagcaatcacatggatatggtgagaatagaatcaccagaggaa
atttctttacttcccaaaacatcctggaatatccctcagcctggtgagggtgatgttcgg
gaggaggccttgtccacagggggacttgatctcatcttcatgccaggccttgggtttgac
aaacatggcaaccgactggggaggggcaagggctactatgatgcctatctgaagcgctgt
ttgcagcatcaggaagtgaagccctacaccctggcgttggctttcaaagaacagatttgc
ctccaggtcccagtgaatgaaaacgacatgaaggtagatgaagtcctttacgaagactcg
tcaacagcttaa

DBGET integrated database retrieval system