KEGG   Homo sapiens (human): 10592Help
Entry
10592             CDS       T01001                                 

Gene name
SMC2, CAP-E, CAPE, SMC-2, SMC2L1
Definition
(RefSeq) structural maintenance of chromosomes 2
  KO
K06674  
structural maintenance of chromosome 2
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Condensin I
    10592 (SMC2)
   Condensin II
    10592 (SMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q31.1
AA seq 1197 aa AA seqDB search
MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIA
AQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFL
LAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLE
DALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLH
ALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLE
KRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTA
LELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGP
DNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPH
GTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWE
MKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKM
KNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
EQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTN
NPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIE
DLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKE
NLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQF
IVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgcatattaagtcaattattctagagggattcaagtcctatgctcagaggaccgaagtc
aatggttttgaccccctcttcaatgctatcactggcttaaatggtagtgggaaatccaac
atattggactccatctgctttttgctgggcatctccaacctgtctcaggttcgggcttct
aatttacaagatttagtttacaaaaatgggcaggctggtattaccaaagcctctgtgtca
atcacttttgataattctgacaaaaagcaaagtcctttaggatttgaggttcatgatgaa
atcacagtaacaaggcaggtggttattggtggtagaaataaatatttaatcaatggagtc
aatgccaacaacaccagagtacaggatctcttctgttctgttggccttaatgttaacaac
cctcactttctcatcatgcagggccgaattacaaaagtattgaatatgaaacctccagag
attttatccatgatagaagaagcagctggaaccaggatgtatgaatacaaaaaaatagct
gcacagaaaactatagaaaaaaaggaggctaagctgaaagaaattaagacgatacttgaa
gaagagattactccaaccattcaaaaattaaaagaggaaagatcgtcctacttggagtac
caaaaagtaatgagagaaatagaacatttgagtcgtttatatattgcttatcagtttttg
ctggctgaagataccaaagtacgctcagctgaggaattaaaagaaatgcaagataaagtt
ataaagcttcaggaagaattgtctgagaatgataaaaaaataaaagcacttaatcatgaa
atagaagaattggaaaaaagaaaagataaggaaactggaggtatacttcgatctttagaa
gatgctcttgcagaggctcagcgagttaatactaaatctcaaagcgcatttgatctcaag
aagaaaaatctggcatgtgaggaaagcaaacgcaaagagctggaaaaaaatatggttgag
gactcaaaaactttagcagcaaaggaaaaagaggttaaaaagataacagatggactgcat
gcccttcaagaagcaagtaataaagatgctgaagctctggcagctgcacagcagcacttc
aatgctgtttccgctggcctgtccagtaatgaagatggagcagaagcaactcttgctggt
caaatgatggcctgtaaaaatgatataagtaaagctcagacagaagccaaacaggctcag
atgaagttgaagcatgctcaacaggaattaaagaataaacaagctgaagttaagaagatg
gatagtggctacaggaaggatcaagaagctctagaagctgtaaaaagacttaaagaaaaa
cttgaagctgaaatgaaaaagctaaattatgaagaaaataaagaggaaagccttttggaa
aagcgcaggcagctgtctcgtgatattggtagattgaaagaaacatatgaagctctatta
gccagatttcccaatcttcgatttgcatacaaggatccagagaagaactggaatagaaat
tgtgtgaaaggacttgtggcttctctgattagtgtgaaagacacttctgcaaccacagct
ttagaattagtggctggagaacgactctacaatgttgtagtagacacagaagttactggt
aaaaagctactagaaaggggggaactgaaacgtcgatacactataattccactcaataaa
atttcagccagatgtattgcaccagaaactctgagagttgctcagaatcttgttggccct
gacaacgttcatgtggctctttccttggttgaatataaaccagaacttcagaaagcaatg
gagtttgtctttggaacaacatttgtttgtgacaatatggataatgccaaaaaagtggcc
tttgataagaggataatgactagaactgtaactctcggaggtgatgtgtttgatcctcat
gggacattgagtggaggtgctcgatcccaggcagcttccattttaaccaagtttcaagaa
ctcaaagatgttcaggatgaactgagaatcaaagagaatgagctgcgggctctagaagag
gaattagcaggtcttaaaaacactgctgaaaagtatcgccaactaaaacagcagtgggag
atgaaaactgaagaggcagatttattacaaaccaagctccagcaaagctcatatcacaag
caacaagaagaattagatgcccttaaaaaaaccattgaggaaagtgaggagactttgaaa
aacactaaagaaatccaaagaaaagcagaagaaaaatatgaagtattggaaaataaaatg
aaaaatgcagaagctgaaagagagcgagaactgaaagatgctcagaaaaaactggattgt
gccaaaacaaaggcagatgcatctagcaagaagatgaaagaaaaacaacaggaagttgaa
gctatcactctggaactggaagagctcaagagagagcatacatcttacaaacaacagctt
gaagctgtaaatgaagctatcaaatcctatgaaagtcagattgaagtaatggcagctgag
gtggctaaaaataaggagtcagtaaataaagctcaagaagaggtgaccaagcaaaaagag
gtgataacagcccaagacactgtaattaaagctaaatatgcagaagtggcaaaacacaag
gagcaaaacaatgattctcagcttaaaattaaggaattagaccacaacatcagcaaacat
aaacgggaggctgaagatggtgctgcaaaggtatccaaaatgttgaaagattatgactgg
attaatgcagagagacacctctttggccaacccaatagtgcctatgatttcaaaactaac
aaccctaaagaagctggtcagagacttcagaagttgcaagaaatgaaggagaaactagga
agaaatgtcaatatgagagctatgaatgtattgacagaagctgaagagcgatacaatgac
ttgatgaagaagaagagaattgtagaaaatgacaaatccaaaattcttacaactatagaa
gaccttgaccagaagaaaaaccaagccctaaatattgcatggcaaaaggtgaacaaggac
tttgggtctattttttctactcttttgcctggtgctaatgctatgcttgcaccaccagag
ggtcaaactgttttggatggtctggagttcaaggttgccttgggaaatacctggaaagaa
aacctaactgaacttagtggtggtcagaggtctttagtggccttgtcattaatactgtcc
atgcttctcttcaaacctgctccaatttatatccttgatgaggtagatgcagccttggat
ctttctcatacccaaaacattggacagatgctgcgtactcatttcacacattctcagttc
attgtggtgtcactaaaagaaggtatgttcaacaatgcaaacgttcttttcaaaaccaag
tttgtggatggtgtttctacagtagccagatttactcaatgtcaaaatggaaagatttca
aaggaagcaaaatccaaggcaaaaccacccaaaggagcacatgtggaagtttaa

DBGET integrated database retrieval system