KEGG   Homo sapiens (human): 10598Help
Entry
10598             CDS       T01001                                 

Gene name
AHSA1, AHA1, C14orf3, hAha1, p38
Definition
(RefSeq) activator of Hsp90 ATPase activity 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24
AA seq 338 aa AA seqDB search
MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTE
VSKLDGEASINNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEIS
VSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPA
LKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPA
TLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETEL
CMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtggggtgagggagacccacgctggatcgtggaggagcgggcggacgccacc
aacgtcaacaactggcactggacggagagagatgcttcaaattggtccacggataagctg
aaaacactgttcctggcagtgcaggttcaaaatgaagaaggcaagtgtgaggtgacggaa
gtgagtaagcttgatggagaggcatccattaacaatcgcaaagggaaacttatcttcttt
tatgaatggagcgtcaaactaaactggacaggtacttctaagtcaggagtacaatacaaa
ggacatgtggagatccccaatttgtctgatgaaaacagcgtggatgaagtggagattagt
gtgagccttgccaaagatgagcctgacacaaatctcgtggccttaatgaaggaagaaggg
gtgaaacttctaagagaagcaatgggaatttacatcagcaccctcaaaacagagttcacc
cagggcatgatcttacctacaatgaatggagagtcagtagacccagtggggcagccagca
ctgaaaactgaggagcgcaaggctaagcctgctccttcaaaaacccaggccagacctgtt
ggagtcaaaatccccacttgtaagatcactcttaaggaaaccttcctgacgtcaccagag
gagctctatagagtgtttaccacccaagagctggtgcaggcctttacccatgctcctgca
acattagaagcagacagaggtggaaagttccacatggtagatggcaacgtctctggggaa
tttactgatctggtccctgagaaacatattgtgatgaagtggaggtttaaatcttggcca
gagggacactttgccaccatcaccttgaccttcatcgacaagaacggagagactgagctg
tgcatggaaggtcgaggcatccctgctcctgaggaagagcggacgcgacagggctggcag
cggtactactttgagggcattaaacagacctttggctatggcgcacgcttattttag

DBGET integrated database retrieval system