KEGG   Homo sapiens (human): 10598Help
Entry
10598             CDS       T01001                                 

Gene name
AHSA1, AHA1, C14orf3, hAha1, p38
Definition
(RefSeq) activator of HSP90 ATPase activity 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Aha1_N AHSA1
Motif
Other DBs
NCBI-GeneID: 10598
NCBI-ProteinID: NP_036243
OMIM: 608466
HGNC: 1189
Ensembl: ENSG00000100591
Vega: OTTHUMG00000171539
Pharos: O95433(Tbio)
UniProt: O95433
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 338 aa AA seqDB search
MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTE
VSKLDGEASINNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEVEIS
VSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPA
LKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPA
TLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETEL
CMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtggggtgagggagacccacgctggatcgtggaggagcgggcggacgccacc
aacgtcaacaactggcactggacggagagagatgcttcaaattggtccacggataagctg
aaaacactgttcctggcagtgcaggttcaaaatgaagaaggcaagtgtgaggtgacggaa
gtgagtaagcttgatggagaggcatccattaacaatcgcaaagggaaacttatcttcttt
tatgaatggagcgtcaaactaaactggacaggtacttctaagtcaggagtacaatacaaa
ggacatgtggagatccccaatttgtctgatgaaaacagcgtggatgaagtggagattagt
gtgagccttgccaaagatgagcctgacacaaatctcgtggccttaatgaaggaagaaggg
gtgaaacttctaagagaagcaatgggaatttacatcagcaccctcaaaacagagttcacc
cagggcatgatcttacctacaatgaatggagagtcagtagacccagtggggcagccagca
ctgaaaactgaggagcgcaaggctaagcctgctccttcaaaaacccaggccagacctgtt
ggagtcaaaatccccacttgtaagatcactcttaaggaaaccttcctgacgtcaccagag
gagctctatagagtgtttaccacccaagagctggtgcaggcctttacccatgctcctgca
acattagaagcagacagaggtggaaagttccacatggtagatggcaacgtctctggggaa
tttactgatctggtccctgagaaacatattgtgatgaagtggaggtttaaatcttggcca
gagggacactttgccaccatcaccttgaccttcatcgacaagaacggagagactgagctg
tgcatggaaggtcgaggcatccctgctcctgaggaagagcggacgcgacagggctggcag
cggtactactttgagggcattaaacagacctttggctatggcgcacgcttattttag

DBGET integrated database retrieval system