KEGG   Homo sapiens (human): 10600Help
Entry
10600             CDS       T01001                                 

Gene name
USP16, UBP-M, UBPM
Definition
(RefSeq) ubiquitin specific peptidase 16 (EC:3.4.19.12)
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     10600 (USP16)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   10600 (USP16)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    10600 (USP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 823 aa AA seqDB search
MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
AEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCD
NEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENM
AKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPD
LALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDS
QELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFG
GELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSE
YEAEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNI
NMDNDLEVLTSSPTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHT
PGTKVYEVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRR
QCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEIL
DLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGD
IPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaatcgatgattcctctgaaacttta
gaacctgtgtgcagacacattagaaaaggattggaacaaggtaatttgaaaaaggcttta
gtgaatgtggaatggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
gctgaagaagaaacagaagaaaagccttcagtttggctgtgtcttaaatgtggccatcag
ggctgtggcagaaattctcaggagcagcatgccttgaagcactatctgacgccaagatct
gaacctcactgtctggttcttagtttggacaactggagtgtatggtgttacgtatgtgat
aatgaggtccagtattgtagttcaaaccagttgggtcaagtggttgattatgtcagaaaa
caagccagcattacaactccaaagccagcagagaaagataatggaaatattgaacttgaa
aataaaaaattagaaaaagagagtaagaatgaacaagagagagaaaagaaggaaaacatg
gctaaagagaatcctcccatgaattctccttgccaaataaccgtgaaaggactcagtaat
ttgggaaacacatgtttcttcaatgcagttatgcagaacttgtcacaaacaccagtgctt
agagaactactaaaagaagtgaaaatgtctggaacaattgtaaaaattgaaccacctgat
ttggcattaacagaaccattagaaataaaccttgagcctccaggccctcttactttagcc
atgagccagtttcttaatgagatgcaagagaccaaaaagggggttgtgacaccgaaagaa
ctcttttctcaggtctgtaaaaaagcagtgcggtttaaaggctatcagcagcaagacagc
caggagctgcttcgctacttattggatgggatgagagcagaagaacaccaaagagtgagt
aaaggaatacttaaagcatttggtaattctactgaaaagttggatgaagaactaaaaaat
aaagttaaagattatgagaagaaaaaatcaatgccaagttttgttgaccgcatctttggt
ggtgaactaactagtatgatcatgtgtgatcaatgcagaactgtctccttggttcatgaa
tctttccttgatttgtccctcccagttttagatgatcagagtggtaagaaaagtgtaaat
gataaaaatctgaaaaagacagtggaggatgaagatcaagatagtgaggaagaaaaagat
aacgacagttacataaaagagagaagtgatattccttctggaacaagtaagcacttacag
aaaaaagcaaagaaacaagccaaaaagcaagccaagaaccaacgaagacaacaaaaaatt
caaggaaaagttcttcatttaaatgatatttgtactattgaccatcctgaagacagtgaa
tatgaagctgaaatgtcacttcaaggagaagtaaatattaaatccaaccatatttcacaa
gagggtgttatgcataaagaatattgtgtcaaccagaaagatttgaatggccaagcaaaa
atgatcgaaagtgtaactgacaatcaaaaatccacagaggaagtagatatgaaaaatatc
aacatggataatgatctggaggttttaacatcttctcccactaggaatttaaatggtgcc
tacctaacggaagggagcaatggagaagtggacatttccaatggtttcaaaaacctaaat
ttgaatgctgctcttcatcctgatgaaataaatatagagattctgaatgatagtcatact
cctggaacaaaggtgtatgaggttgtaaatgaagatccagaaactgctttctgtactctt
gcaaacagggaagttttcaatactgatgagtgttcaatccaacattgtttatatcagttc
acccgtaatgagaaacttcgagatgcgaataaactgctttgtgaagtatgcacacggaga
cagtgtaatggaccaaaggcaaatataaaaggtgaaaggaagcatgtttacaccaatgcc
aaaaagcagatgctaatttctcttgctcctcctgttcttactcttcatttaaagagattt
cagcaggctggttttaacctacgcaaagttaacaaacacataaagtttccggaaatctta
gatttggctcctttttgcacccttaaatgtaagaatgttgcagaagaaaatacaagggta
ctctattccttatatggagttgttgaacacagtggtactatgaggtcggggcattacact
gcctatgccaaggcaagaaccgcaaatagtcatctctctaatcttgttcttcacggtgat
attccacaagattttgaaatggaatcaaaagggcagtggtttcacatcagcgacacacat
gtgcaagctgtgcctacaactaaagtactaaactcacaagcgtacctcctattttatgag
agaatactgtaa

DBGET integrated database retrieval system