KEGG   Homo sapiens (human): 10600Help
Entry
10600             CDS       T01001                                 

Gene name
USP16, UBP-M, UBPM
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 822 aa AA seqDB search
MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
AEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCD
NEVQYCSSNQLGQVVDYVRKQASITTPKPEKDNGNIELENKKLEKESKNEQEREKKENMA
KENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFGG
ELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKDN
DSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEY
EAEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNIN
MDNDLEVLTSSPTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTP
GTKVYEVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRRQ
CNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEILD
LAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGDI
PQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaatcgatgattcctctgaaacttta
gaacctgtgtgcagacacattagaaaaggattggaacaaggtaatttgaaaaaggcttta
gtgaatgtggaatggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
gctgaagaagaaacagaagaaaagccttcagtttggctgtgtcttaaatgtggccatcag
ggctgtggcagaaattctcaggagcagcatgccttgaagcactatctgacgccaagatct
gaacctcactgtctggttcttagtttggacaactggagtgtatggtgttacgtatgtgat
aatgaggtccagtattgtagttcaaaccagttgggtcaagtggttgattatgtcagaaaa
caagccagcattacaactccaaagccagagaaagataatggaaatattgaacttgaaaat
aaaaaattagaaaaagagagtaagaatgaacaagagagagaaaagaaggaaaacatggct
aaagagaatcctcccatgaattctccttgccaaataaccgtgaaaggactcagtaatttg
ggaaacacatgtttcttcaatgcagttatgcagaacttgtcacaaacaccagtgcttaga
gaactactaaaagaagtgaaaatgtctggaacaattgtaaaaattgaaccacctgatttg
gcattaacagaaccattagaaataaaccttgagcctccaggccctcttactttagccatg
agccagtttcttaatgagatgcaagagaccaaaaagggggttgtgacaccgaaagaactc
ttttctcaggtctgtaaaaaagcagtgcggtttaaaggctatcagcagcaagacagccag
gagctgcttcgctacttattggatgggatgagagcagaagaacaccaaagagtgagtaaa
ggaatacttaaagcatttggtaattctactgaaaagttggatgaagaactaaaaaataaa
gttaaagattatgagaagaaaaaatcaatgccaagttttgttgaccgcatctttggtggt
gaactaactagtatgatcatgtgtgatcaatgcagaactgtctccttggttcatgaatct
ttccttgatttgtccctcccagttttagatgatcagagtggtaagaaaagtgtaaatgat
aaaaatctgaaaaagacagtggaggatgaagatcaagatagtgaggaagaaaaagataac
gacagttacataaaagagagaagtgatattccttctggaacaagtaagcacttacagaaa
aaagcaaagaaacaagccaaaaagcaagccaagaaccaacgaagacaacaaaaaattcaa
ggaaaagttcttcatttaaatgatatttgtactattgaccatcctgaagacagtgaatat
gaagctgaaatgtcacttcaaggagaagtaaatattaaatccaaccatatttcacaagag
ggtgttatgcataaagaatattgtgtcaaccagaaagatttgaatggccaagcaaaaatg
atcgaaagtgtaactgacaatcaaaaatccacagaggaagtagatatgaaaaatatcaac
atggataatgatctggaggttttaacatcttctcccactaggaatttaaatggtgcctac
ctaacggaagggagcaatggagaagtggacatttccaatggtttcaaaaacctaaatttg
aatgctgctcttcatcctgatgaaataaatatagagattctgaatgatagtcatactcct
ggaacaaaggtgtatgaggttgtaaatgaagatccagaaactgctttctgtactcttgca
aacagggaagttttcaatactgatgagtgttcaatccaacattgtttatatcagttcacc
cgtaatgagaaacttcgagatgcgaataaactgctttgtgaagtatgcacacggagacag
tgtaatggaccaaaggcaaatataaaaggtgaaaggaagcatgtttacaccaatgccaaa
aagcagatgctaatttctcttgctcctcctgttcttactcttcatttaaagagatttcag
caggctggttttaacctacgcaaagttaacaaacacataaagtttccggaaatcttagat
ttggctcctttttgcacccttaaatgtaagaatgttgcagaagaaaatacaagggtactc
tattccttatatggagttgttgaacacagtggtactatgaggtcggggcattacactgcc
tatgccaaggcaagaaccgcaaatagtcatctctctaatcttgttcttcacggtgatatt
ccacaagattttgaaatggaatcaaaagggcagtggtttcacatcagcgacacacatgtg
caagctgtgcctacaactaaagtactaaactcacaagcgtacctcctattttatgagaga
atactgtaa

DBGET integrated database retrieval system