KEGG   Homo sapiens (human): 10603Help
Entry
10603             CDS       T01001                                 

Gene name
SH2B2, APS
Definition
SH2B adaptor protein 2
Orthology
K07193  
SH2B adapter protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    10603 (SH2B2)
  Nervous system
   04722 Neurotrophin signaling pathway
    10603 (SH2B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22
AA seq 675 aa AA seqDB search
MDPSYCPAHGFPSQDPLWPLSSQQWSSAHYSEPAAGGCDGTEAMNGAGPGPAAAAPVPVP
VPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFLDVFGEEV
RRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSL
RNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLRLSRTLAAKVELVDIQRE
GALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLSAII
EVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELS
CTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHSRGRDAVRESLIHVPLET
FLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHGTLSRVKAAQLVLAGGPR
NHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHFHTH
PIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAACPP
ASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEPPEA
APGRARAVENQYSFY
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatccaagctattgtcctgcccatggcttcccatctcaggaccctctctggccgcta
tcatcccagcagtggagttcagcccactactctgaaccagccgcaggtggctgcgatggg
acggaagccatgaatggtgccggccctggccccgccgcagccgccccggtcccagtcccg
gtcccggtcccggactggcggcagttctgcgagctgcatgcgcaggcggccgccgtggac
tttgcgcacaagttctgccgtttcctgcgggacaacccagcttacgacacgcccgacgcc
ggcgcctccttctcccgccacttcgccgccaacttcctggacgtcttcggcgaggaggtg
cgccgcgtgctggtggctgggccgacgactcggggcgcggccgtgagcgcagaggccatg
gagccggagctcgcggacacctctgcactcaaggcggcgccctacggccactcgcggagc
tcggaggacgtgtccacgcacgcggccaccaaggcccgcgttcgcaagggcttctcgctg
cgcaacatgagcctgtgcgtggtggacggcgtgcgcgacatgtggcaccggcgcgcctcg
cccgagcccgacgcggcagctgccccgcgcaccgccgagccccgcgacaagtggacgcgg
cgcctgaggctgtcgcggacgctggctgccaaggtggagctggtggacattcaacgcgag
ggggcgctgcgcttcatggtggccgacgacgcggccgcgggctccgggggctcggctcag
tggcagaagtgccgcctgctcctgcgcagggctgtggccgaggaacgcttccgcctggag
ttcttcgtgccgcccaaagcctccaggcccaaggtcagcatcccactgtcagccatcatt
gaggtccgcaccaccatgcccctggaaatgccagagaaggataacacattcgtcctcaag
gtagagaatggagccgaatacatcttggagaccatcgactctctgcagaagcactcgtgg
gtagctgacatccagggctgcgtggaccccggtgacagtgaggaagacaccgagctctcc
tgtacccgaggaggctgtctggccagccgcgtggcctcctgcagctgtgagctcctgact
gatgcagtcgacctgccccgccccccagagacgacagccgtgggtgcagtggtgacagcc
ccccacagccgaggtcgagatgccgtcagagaatccctgatccacgtcccgctagagacc
tttctgcagaccctggaatccccgggcggcagcggcagtgacagcaataacacaggggaa
cagggtgcagagacggatcccgaggctgaacccgagctggagctatccgactacccatgg
ttccacgggacactgtcccgggtcaaggctgctcaactggttctggcaggggggccccgg
aaccacggcctcttcgtgatccgccaaagtgagactcggcctggggagtacgtgctgacc
ttcaacttccagggcaaggccaagcacctgcgcctgtccctgaacggccacggccagtgt
cacgtacagcatctgtggttccagtctgtgcttgacatgctccgccacttccacacacac
cccatcccactggagtcagggggctcggccgacatcacccttcgcagctatgtgcgggcc
caggaccccccaccagagccgggccccacgccccctgccgcgcccgcgtccccggcctgc
tggagcgactcgcccggccagcactacttctccagcctcgccgcggccgcctgcccgcct
gcctcgccctccgacgccgccggcgcctcctcgtcttccgcctcgtcgtcctctgccgcg
tcggggcccgcccccccgcgccccgtcgagggccagctcagcgcgcggagccgcagcaac
agcgccgagcgcctgctggaggccgtggccgccaccgccgccgaggagcccccggaggcc
gcgcccggccgcgcgcgcgccgtggagaaccagtactccttctactag

DBGET integrated database retrieval system